DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and NDPK2

DIOPT Version :10

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_568970.2 Gene:NDPK2 / 836451 AraportID:AT5G63310 Length:231 Species:Arabidopsis thaliana


Alignment Length:144 Identity:42/144 - (29%)
Similarity:64/144 - (44%) Gaps:22/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIP-MVAQLA 311
            |..::||..|:.||:|:|||.....||:|..::|....:...||.|:...  ...:.| ::..:.
plant    86 TYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLS--AKSFFPNLIEYIT 148

  Fly   312 SG--VCMCME----IACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTD 370
            ||  |||..|    :|.|          |...|..||..|:   |.|:|........:|.||.:|
plant   149 SGPVVCMAWEGVGVVASA----------RKLIGKTDPLQAE---PGTIRGDLAVQTGRNIVHGSD 200

  Fly   371 LPDDSNLELQYMFK 384
            .|::...|:...||
plant   201 SPENGKREIGLWFK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDPk7B 246..383 CDD:239875 40/141 (28%)
NDPK2NP_568970.2 NDPk_I 84..213 CDD:239876 40/141 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.