DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and AT4G23900

DIOPT Version :10

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_567690.1 Gene:AT4G23900 / 828490 AraportID:AT4G23900 Length:237 Species:Arabidopsis thaliana


Alignment Length:146 Identity:31/146 - (21%)
Similarity:64/146 - (43%) Gaps:26/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYE------VYRGVVPEYI-- 304
            |...|||..::.||:.:||:.....|::|..:::::.::...::.|.      .:.|:. .::  
plant    90 TFIAIKPDGVQRGLISEIITRFERKGYKLVGIKVMVPSKGFAQKHYHDLKERPFFNGLC-NFLSS 153

  Fly   305 -PMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHC 368
             |:||.:..|             :...|..|...|..||:.::   |.|:|........:|.:|.
plant   154 GPVVAMVWEG-------------EGVIRYGRKLIGATDPQKSE---PGTIRGDLAVVVGRNIIHG 202

  Fly   369 TDLPDDSNLELQYMFK 384
            :|.|:.:..|:...||
plant   203 SDGPETAKDEISLWFK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDPk7B 246..383 CDD:239875 29/143 (20%)
AT4G23900NP_567690.1 PLN02619 1..237 CDD:178228 31/146 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.