DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and NDPK3

DIOPT Version :10

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_192839.1 Gene:NDPK3 / 826702 AraportID:AT4G11010 Length:238 Species:Arabidopsis thaliana


Alignment Length:182 Identity:40/182 - (21%)
Similarity:75/182 - (41%) Gaps:52/182 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 YSDNDNDV---EMDLKFISEARHSIIKECVFKNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTA 278
            |...|.:|   ||:..||:                   |||..::.||:.:|||.....||:|..
plant    76 YMIQDQEVLAAEMERTFIA-------------------IKPDGVQRGLISEIISRFERKGFKLVG 121

  Fly   279 MRMILMARINCEEFYE------VYRGVVPEYI---PMVAQL--ASGVCMCMEIACADPEKKTDRE 332
            :::|:.::...::.|.      .:.|:. :::   |::|.:  ..||.               |.
plant   122 IKVIVPSKDFAQKHYHDLKERPFFNGLC-DFLSSGPVIAMVWEGDGVI---------------RY 170

  Fly   333 FRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSNLELQYMFK 384
            .|...|..||:.::   |.|:|.....:..:|.:|.:|.|:.:..|:...||
plant   171 GRKLIGATDPQKSE---PGTIRGDLAVTVGRNIIHGSDGPETAKDEISLWFK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDPk7B 246..383 CDD:239875 31/147 (21%)
NDPK3NP_192839.1 PLN02619 1..238 CDD:178228 40/182 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.