DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and Nme3

DIOPT Version :10

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_062704.2 Gene:Nme3 / 79059 MGIID:1930182 Length:169 Species:Mus musculus


Alignment Length:142 Identity:34/142 - (23%)
Similarity:61/142 - (42%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIPMVAQLAS 312
            |...:||..::..|:|:|:......||:|.|::::..:.....|.|...| ..|.|..:|..::|
Mouse    24 TFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYVELR-EKPFYSRLVKYMSS 87

  Fly   313 GVCMCM-----EIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLP 372
            |..:.|     ::..|.         |...|..||..|   .|.|:|..|.....:|.:|.:|..
Mouse    88 GPVVAMVWQGLDVVHAS---------RALIGATDPGDA---MPGTIRGDFCMEVGKNVIHGSDSV 140

  Fly   373 DDSNLELQYMFK 384
            :.::.|:...|:
Mouse   141 ESAHREIALWFR 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDPk7B 246..383 CDD:239875 33/139 (24%)
Nme3NP_062704.2 NDPk_I 22..151 CDD:239876 33/139 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.