DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and Nme8

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_853622.2 Gene:Nme8 / 73412 MGIID:1920662 Length:586 Species:Mus musculus


Alignment Length:269 Identity:69/269 - (25%)
Similarity:114/269 - (42%) Gaps:57/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DNKINI--NQGMMVQFSPKMVTQFLSGKDTTDVSS--------SVLMNELLAGPAISLELIGDNV 176
            |:.:|:  |:|..:....::|   ||.::...|..        ..|:..:.:..:..|.|..:|.
Mouse   329 DDVLNVIHNEGFTILMQRQIV---LSEEEARTVCKIHENEEYFDNLIGHMTSNHSYVLALRRENG 390

  Fly   177 VETIKACAQYKSTE---AETPSVKLSPSLEELFESEEIRYGFYYSDNDNDVEMDLKFISEARHSI 238
            ||..|.....|:.|   |..|.     ||...|.|.......:|.             |.::.:.
Mouse   391 VEYWKTLIGPKTIEEAYASHPQ-----SLCVQFASGNFPTNQFYG-------------SSSKAAA 437

  Fly   239 IKECVF---KNTTLAIIKPH-SIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFY------ 293
            .||...   ..:|||:|||| :.|:.:  :|:..|...||.||.|:.:.:...:..:.|      
Mouse   438 EKEIAHFFPPQSTLALIKPHVTHKERM--EILKTIKEAGFELTLMKEMHLTPEHANKIYFKITGK 500

  Fly   294 EVYRGVVPEYIPMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFG 358
            :.|:.|       :..|:.|:.:.|.:.    :.....|:|...||:|||.||||.|.:||||:|
Mouse   501 DFYKNV-------LEVLSLGMSLVMVLT----KWNAVAEWRRMVGPVDPEEAKLLSPESLRAKYG 554

  Fly   359 KSKVQNAVH 367
            ...::||||
Mouse   555 LDILRNAVH 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 42/129 (33%)
NDPk7B 246..383 CDD:239875 42/129 (33%)
Nme8NP_853622.2 TRX_NDPK 11..113 CDD:239246
NDPk 155..301 CDD:260363
NDK 1 157..254
NDK 2 312..452 28/143 (20%)
NDK 313..450 CDD:197791 27/141 (19%)
NDPk_TX 313..445 CDD:239879 27/136 (20%)
NDK 448..581 CDD:197791 42/129 (33%)
NDPk 448..579 CDD:260363 42/129 (33%)
NDK 3 453..586 39/124 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.