DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and Nme9

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001159429.1 Gene:Nme9 / 623534 MGIID:4359686 Length:263 Species:Mus musculus


Alignment Length:208 Identity:53/208 - (25%)
Similarity:87/208 - (41%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 YKSTEAETPSV--KLSPSLEELFESEEIRYGFYYSDNDNDVEMDLKFISEARH--------SIIK 240
            :.|.||:...|  |.....|..|        .:|:..|.::...||:....:.        |..|
Mouse    41 FASAEADRLDVLEKYQGKCEPTF--------LFYTATDEELLGALKWPPHRKDGGEDGDIASSGK 97

  Fly   241 ECVFKNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIP 305
            .|     ||.||||.::..|...:||.:|...||.:.......:.....:.||: :|.....:..
Mouse    98 TC-----TLGIIKPDAVAHGKAEEIIMKIQEAGFDILLKEERTLTEAEMQAFYQ-HRAREEAFER 156

  Fly   306 MVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTD 370
            :|..:.||....:.:...:..:.....:|.|.||.||.:|:...|.:|||::|.....||||.:.
Mouse   157 LVHHMCSGPSHLLILTKTEGTEDVVTAWRTFLGPCDPNVARREHPESLRAQYGTEMPFNAVHGSR 221

  Fly   371 LPDDSNLELQYMF 383
            ..:|:|.||..:|
Mouse   222 DREDANRELALLF 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 39/138 (28%)
NDPk7B 246..383 CDD:239875 38/136 (28%)
Nme9NP_001159429.1 Thioredoxin_like 1..>67 CDD:294274 7/33 (21%)
NDPk_TX 98..234 CDD:239879 39/141 (28%)
NDK 99..239 CDD:197791 40/142 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.