DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and Nme6

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001178813.1 Gene:Nme6 / 58964 RGDID:61896 Length:186 Species:Rattus norvegicus


Alignment Length:148 Identity:39/148 - (26%)
Similarity:67/148 - (45%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SIIKECVFKNTTLAIIKPHSIKDGLLGDII-SEILSNGFRLTAMRMILMARINCEEFYEVYRGVV 300
            ||::.......|||:|||.::...|:.:.: .:||||.|.:..||.:|....:|..||..:.|..
  Rat     3 SILRSPQTLQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWKPEDCRRFYREHEGRF 67

  Fly   301 PEYIPMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNA 365
             .|..:|..:.||......:|    .|...:.:|...||.....|:.:.|.::|...|.:..:|.
  Rat    68 -FYQRLVEFMTSGPIRAYILA----HKDAIQLWRTLMGPTRVFRARHIAPDSIRGSLGLTDTRNT 127

  Fly   366 VHCTDLPDDSNLELQYMF 383
            .|.:|....::.|:...|
  Rat   128 THGSDSVVSASREIAAFF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 37/139 (27%)
NDPk7B 246..383 CDD:239875 36/137 (26%)
Nme6NP_001178813.1 NDK 12..149 CDD:197791 37/139 (27%)
NDPk6 12..146 CDD:239877 37/139 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.