DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and nme6

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_571672.2 Gene:nme6 / 58120 ZFINID:ZDB-GENE-000710-3 Length:175 Species:Danio rerio


Alignment Length:136 Identity:32/136 - (23%)
Similarity:62/136 - (45%) Gaps:5/136 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIPMVAQLAS 312
            |||:|||.::...|:.:.:.:.:...|.:...:.::..:.:.|.||..:.|.. .:..:|..::|
Zfish    10 TLAVIKPDAMAHPLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRF-FFQRLVEFMSS 73

  Fly   313 GVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSNL 377
            |......:|..|    ....:|...||.....|:...|.|||.|:|.:..:|..|.:|..:.:..
Zfish    74 GPMRAYILARED----AITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKR 134

  Fly   378 ELQYMF 383
            |:.:.|
Zfish   135 EISFFF 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 32/136 (24%)
NDPk7B 246..383 CDD:239875 31/134 (23%)
nme6NP_571672.2 NDK 8..144 CDD:197791 32/136 (24%)
NDPk6 8..141 CDD:239877 32/136 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.