DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and NME4

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_005000.1 Gene:NME4 / 4833 HGNCID:7852 Length:187 Species:Homo sapiens


Alignment Length:142 Identity:38/142 - (26%)
Similarity:59/142 - (41%) Gaps:12/142 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 KNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIPMVAQ 309
            :..||..:||..::..|:||:|......||.|..|:|:........|.|:..|. .|.|..::..
Human    37 RERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRR-KPFYPALIRY 100

  Fly   310 LASG--VCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLP 372
            ::||  |.|..|      .....|..|...|..|...|   .|.|:|..|.....:|.:|.:|..
Human   101 MSSGPVVAMVWE------GYNVVRASRAMIGHTDSAEA---APGTIRGDFSVHISRNVIHASDSV 156

  Fly   373 DDSNLELQYMFK 384
            :.:..|:|..|:
Human   157 EGAQREIQLWFQ 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 38/141 (27%)
NDPk7B 246..383 CDD:239875 37/138 (27%)
NME4NP_005000.1 NDK 38..172 CDD:197791 38/141 (27%)
NDPk_I 38..167 CDD:239876 37/138 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.