DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and awd

DIOPT Version :10

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_476761.3 Gene:awd / 43739 FlyBaseID:FBgn0000150 Length:168 Species:Drosophila melanogaster


Alignment Length:148 Identity:35/148 - (23%)
Similarity:61/148 - (41%) Gaps:26/148 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 KNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFY------EVYRGVVPEY 303
            |..|..::||..::.||:|.||......||:|.|::....::...|:.|      ..:.|:| .|
  Fly    20 KERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLV-NY 83

  Fly   304 I---PMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNA 365
            :   |:|..:..|:.:.          ||.|:......|.|.      .|.|:|..|.....:|.
  Fly    84 MNSGPVVPMVWEGLNVV----------KTGRQMLGATNPADS------LPGTIRGDFCIQVGRNI 132

  Fly   366 VHCTDLPDDSNLELQYMF 383
            :|.:|..:.:..|:...|
  Fly   133 IHGSDAVESAEKEIALWF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDPk7B 246..383 CDD:239875 33/145 (23%)
awdNP_476761.3 PTZ00093 19..167 CDD:173387 35/148 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.