DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and nme5

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001002516.1 Gene:nme5 / 436789 ZFINID:ZDB-GENE-040718-221 Length:217 Species:Danio rerio


Alignment Length:167 Identity:46/167 - (27%)
Similarity:82/167 - (49%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 DNDNDVEMDLKFISEARHSIIKECVFKNTTLAIIKPHSI-KDGLLGDIISEILSNGFRLTAMRMI 282
            :||:    ..|.:.|.|       :|...|||:|||.:| |...:.||   ||.:||.:...|.:
Zfish     2 ENDD----PQKLMPEPR-------IFVERTLALIKPDAIHKTDEIEDI---ILQSGFTILQKRRL 52

  Fly   283 LMARINCEEFYEVYRGVVPEYIP-MVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAK 346
            .::...|.:||..:.|.:  :.| :.|.::||..:.:.:|    ..:....::...||:....|:
Zfish    53 QLSPEQCSDFYAEHYGKL--HFPHLTAFMSSGPVVALALA----RDQAIATWKAIMGPVSSIKAR 111

  Fly   347 LLRPHTLRAKFGKSKVQNAVHCTDLPDDSNLELQYMF 383
            ...|..|||:||...::||||.::....:..|:::||
Zfish   112 ETHPDCLRARFGTCDLRNAVHGSETFSAAEREIRFMF 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 40/140 (29%)
NDPk7B 246..383 CDD:239875 38/138 (28%)
nme5NP_001002516.1 NDK 18..153 CDD:278749 40/140 (29%)
NDPk5 18..149 CDD:239880 40/140 (29%)
Dpy-30 161..202 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.