DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and CG15547

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_651833.1 Gene:CG15547 / 43661 FlyBaseID:FBgn0039809 Length:390 Species:Drosophila melanogaster


Alignment Length:294 Identity:54/294 - (18%)
Similarity:106/294 - (36%) Gaps:85/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LLKNNMWTKHLGKFLKTLIDNKININQGMMVQFSPKMVTQFLSGKDTTDVSSSVLMNELLA-GPA 166
            ::|.:...|.....||.|.:. ..|.....:.|||:...:|.:  |..|....:|...||: |.:
  Fly     8 IIKPDYLHKRRPVLLKLLAEG-FQIQGNRRIAFSPETAAEFYA--DYADEKGFMLEVILLSKGVS 69

  Fly   167 ISLELIGDNVVE---TIKACAQYKSTEAETPSVKLSPSLEELFESEEIRYGFYYSDNDNDVEMDL 228
            .:..:..:|.|:   .|..|                                 |..:.:|:|.::
  Fly    70 EAFIVTKENAVQELLNIMIC---------------------------------YFGSASDLERNI 101

  Fly   229 KFISEARHSIIKEC--VFKNTTLAIIKPHSIKD-------GLLGDIISEILSNGFRLTAMRMILM 284
             .:::..:|:.:|.  :|.|   .|.:||.:.|       .:|..::.||..           :|
  Fly   102 -HVTKNSYSVAREINFIFPN---YIHEPHQMFDHNNFCNRPMLKPLLEEIYD-----------IM 151

  Fly   285 ARINCEEFYEVYRGVVPEYI----PMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIA 345
            ...:|.:  |.::..|.:|:    |.:.::::......::|..|..::|...:    .|      
  Fly   152 QNTDCSQ--ENWKVRVSDYLVRSNPKMPEISNQCQQRPDVAIQDKSQQTTMTY----AP------ 204

  Fly   346 KLLRPHTLRAKFGKSKVQ--NAVHCTDLPDDSNL 377
               :|....|:.|..|.|  :|...|..|..|.|
  Fly   205 ---KPSARAAQPGVKKTQSSSAPLSTTSPHSSML 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 28/145 (19%)
NDPk7B 246..383 CDD:239875 28/145 (19%)
CG15547NP_651833.1 NDK 3..120 CDD:197791 26/148 (18%)
NDPk 3..119 CDD:260363 25/147 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465020
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.