DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and nme4

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_957489.1 Gene:nme4 / 394170 ZFINID:ZDB-GENE-040426-1043 Length:190 Species:Danio rerio


Alignment Length:150 Identity:40/150 - (26%)
Similarity:64/150 - (42%) Gaps:25/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMI-----LMARINCEEFYEVYRGVVPEYIPMV 307
            ||..:||..::..|:|::|......||||..::|:     |:|:      :.|.....|.|..::
Zfish    44 TLVAVKPDGVQRRLIGEVIKRFEQRGFRLVGLKMLQAPDKLLAQ------HYVSLQKKPFYSSLL 102

  Fly   308 AQLASG--VCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTD 370
            ..:.||  |.|..|   .....||.   |...|..||..|   .|.|:|..|.....:|.||.:|
Zfish   103 YYMTSGPIVAMVWE---GHNVVKTS---RMMVGDTDPAAA---APGTIRGDFSVHISRNVVHASD 158

  Fly   371 LPDDSNLELQYMF---KIID 387
            ..:.:..|:...|   :::|
Zfish   159 SVEGAQREISLWFHRSELVD 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 39/148 (26%)
NDPk7B 246..383 CDD:239875 38/141 (27%)
nme4NP_957489.1 NDK 42..176 CDD:278749 39/146 (27%)
NDPk_I 42..171 CDD:239876 38/141 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.