DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and Nme8

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_942087.2 Gene:Nme8 / 364729 RGDID:735069 Length:596 Species:Rattus norvegicus


Alignment Length:266 Identity:68/266 - (25%)
Similarity:115/266 - (43%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DNKINI--NQGMMVQFSPKMVTQFLSGKDTTDVSS--------SVLMNELLAGPAISLELIGDNV 176
            ||.::|  |:|..:....::|   ||.::...|..        ..|:..:.:..:..|.|:.::.
  Rat   339 DNVLDIIQNEGFTILMQRQVV---LSEEEARAVCHVHEDEDYFDNLIGYMCSNNSYILVLMREHS 400

  Fly   177 VETIKACAQYKSTE---AETPSVKLSPSLEELFESEEIRYGFYYSDNDNDVEMDLKFISEARHSI 238
            ||..|.....|:.|   |..|.     ||...|.|.......:|..:.          ..|..:.
  Rat   401 VERWKELIGPKTVEEAYASHPD-----SLCVRFASGNFPVNQFYGSSS----------KAAAETE 450

  Fly   239 IKECVFKNTTLAIIKPH-SIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFY------EVY 296
            |:......:|||:|||| |.|:.:  :|:..|....|.||.|:.:.:...:..:.|      :.|
  Rat   451 IEHFFPPQSTLALIKPHVSHKERM--EILKAIRDARFELTQMKEMHLTPEHASKVYFKITGKDFY 513

  Fly   297 RGVVPEYIPMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSK 361
            :.|:.       .|:||:.:.|.:.    :.....|:|...||:|||.||||.|::|||::|...
  Rat   514 KNVLD-------VLSSGMSVVMILT----KWNAVGEWRRMMGPVDPEEAKLLSPNSLRARYGIDV 567

  Fly   362 VQNAVH 367
            ::||||
  Rat   568 LRNAVH 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 42/129 (33%)
NDPk7B 246..383 CDD:239875 42/129 (33%)
Nme8NP_942087.2 TRX_NDPK 11..113 CDD:239246
NDPk_TX 155..311 CDD:239879
NDK 2 322..462 27/140 (19%)
NDPk_TX 323..455 CDD:239879 26/133 (20%)
NDPk 458..589 CDD:238335 42/129 (33%)
NDK 3 463..596 39/124 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.