DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and nmdyn-D6

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_572965.1 Gene:nmdyn-D6 / 32396 FlyBaseID:FBgn0030573 Length:151 Species:Drosophila melanogaster


Alignment Length:152 Identity:35/152 - (23%)
Similarity:62/152 - (40%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVV------------ 300
            |||:||||.:::......|..::|..|.:...:.:.:.:...|.||..::|..            
  Fly     4 TLALIKPHVLRNTYAMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSG 68

  Fly   301 PEYIPMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNA 365
            |.|..:   |.|..|:              :::|:..||.....|....|:.:||.:|.|..:||
  Fly    69 PSYALI---LQSETCI--------------QKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNA 116

  Fly   366 VHCTDLPDDSNLELQYMFKIID 387
            .|.:|....:..|:..:|...|
  Fly   117 CHGSDSEASALREISILFPEFD 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 34/150 (23%)
NDPk7B 246..383 CDD:239875 33/146 (23%)
nmdyn-D6NP_572965.1 NDK 2..138 CDD:197791 34/150 (23%)
NDPk6 2..135 CDD:239877 33/147 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465022
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.