DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and Y48G8AL.15

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001021779.1 Gene:Y48G8AL.15 / 259363 WormBaseID:WBGene00021692 Length:139 Species:Caenorhabditis elegans


Alignment Length:144 Identity:34/144 - (23%)
Similarity:68/144 - (47%) Gaps:23/144 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LAIIKPHSIKDGLLGDI-ISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIPMVAQLAS 312
            |.::||..:...:|..: :||:.|||..:..||.:.::....::.|..::|.. .|..:|..::|
 Worm    13 LVVLKPEIVAHRVLAQVALSELRSNGIEIEEMRQMKISGSLAKQLYAQHQGKF-FYDRLVRHISS 76

  Fly   313 GVCMCMEIA-----CADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLP 372
            |..:.|.::     |....:            :.|.:...::|  :|.:|..|.|:|..|.:| .
 Worm    77 GPVIAMRVSGNARKCIGSSR------------LWPRLEPTVQP--IRQRFALSDVRNVAHASD-E 126

  Fly   373 DDSNLELQYMFKII 386
            |.:..||| :|::|
 Worm   127 DAAEKELQ-LFELI 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 34/144 (24%)
NDPk7B 246..383 CDD:239875 32/139 (23%)
Y48G8AL.15NP_001021779.1 NDK 13..136 CDD:197791 32/139 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0105
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.