DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and nme6

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001123709.1 Gene:nme6 / 100170458 XenbaseID:XB-GENE-969918 Length:179 Species:Xenopus tropicalis


Alignment Length:137 Identity:33/137 - (24%)
Similarity:66/137 - (48%) Gaps:6/137 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 TLAIIKPHSIKDGLLGDII-SEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIPMVAQLA 311
            |||:|||.::.:.::.:.: .:||.|.|.:...:.:.....:.:.||..::|.. .|..:|..::
 Frog    13 TLALIKPDAVANPVISEAVHQKILENNFLIIRHKELHWRSTDSQRFYCEHKGRF-FYQRLVEFMS 76

  Fly   312 SGVCMCMEIACADPEKKTDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSN 376
            ||......:|..|..:.    :||..||.....|:::.|.|:|...|.:..:|..|.:|..:.:.
 Frog    77 SGPMQAYILAHEDAVQL----WRNLMGPTKVFRARIVAPGTVRGDLGLTDTRNTTHGSDSVESAC 137

  Fly   377 LELQYMF 383
            .|:.:.|
 Frog   138 REITFFF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 33/137 (24%)
NDPk7B 246..383 CDD:239875 32/135 (24%)
nme6NP_001123709.1 NDPk6 11..145 CDD:239877 33/137 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.