DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and nme9

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_012825581.1 Gene:nme9 / 100158550 XenbaseID:XB-GENE-5862235 Length:620 Species:Xenopus tropicalis


Alignment Length:303 Identity:69/303 - (22%)
Similarity:142/303 - (46%) Gaps:45/303 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KKGFVLLKNNMWTKHLGKFLKTLIDNKININQGMMVQFSPKMVTQFLSGKDTTDVSSSVLMNELL 162
            ::...|::.::......:.|:::.|...:|.....|..:.:.|.:|.......|...: |:.::.
 Frog   314 ERTLALIRPDILKDKKDEILQSIRDAGFSIAMQKEVMLTEQQVQEFYIEHIDKDYYPA-LLKQMT 377

  Fly   163 AGPAISLELIGDNVVE---TIKACAQYKSTEAETPSVKLSPSLEELFESEEIRYGFYYSDND--- 221
            :||.::|.|:.|:.|:   .:...|..:...:|.|              :.:|..|..:|:|   
 Frog   378 SGPVLALALVKDHAVDHWRNMLGPASLRQALSEAP--------------DSLRAQFAPNDSDINQ 428

  Fly   222 -------NDVEMDLKFISEARHSIIKECVFKNTTLAIIKPHSIKDGLLGDIISEILSNGFRLTAM 279
                   .:.:.:|.|.....|           |||.|||.::::. ..:|:.:|...||.::.:
 Frog   429 LHGSSTPEEAKKELNFFFPVEH-----------TLATIKPDALEEH-RDEILEQIQGTGFTISQI 481

  Fly   280 RMILMARINCEEFYEVYRGVVPEYIPMVAQLASGVCMCMEIACADPEKKTDREFRNFCGPMDPEI 344
            :...::|...||||:.::| .|.:..:|..:..|.|:.|.::    ::...:|:|:..||.||..
 Frog   482 KEANLSREMAEEFYKEHKG-KPFFEQLVNYMCRGPCLMMILS----KENAVQEWRSLMGPTDPTE 541

  Fly   345 AKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSNLELQYMFKIID 387
            |:.:.|.:|||||.||.:|||||.:...:.:..:::::|..||
 Frog   542 AQKVSPDSLRAKFAKSILQNAVHGSSNGEHAMEKMKFIFGDID 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921
NDK 246..387 CDD:197791 42/140 (30%)
NDPk7B 246..383 CDD:239875 41/136 (30%)
nme9XP_012825581.1 TRX_NDPK 11..112 CDD:239246
NDPk 159..295 CDD:238335
NDPk_TX 314..446 CDD:239879 24/146 (16%)
NDPk_TX 449..580 CDD:239879 42/147 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.