DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nmdyn-D7 and nme9

DIOPT Version :9

Sequence 1:NP_649926.2 Gene:nmdyn-D7 / 41174 FlyBaseID:FBgn0028997 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_021334262.1 Gene:nme9 / 100037319 ZFINID:ZDB-GENE-070410-39 Length:665 Species:Danio rerio


Alignment Length:315 Identity:72/315 - (22%)
Similarity:134/315 - (42%) Gaps:77/315 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 DTTRTN----LAKYRKKGFVLLKNNMWTKHLGKFLKTLIDNKININQGMMVQFSPKMVTQFLSGK 147
            |..|.|    |::.|:.||                      ::.:.:.:|:  :.:.|..|.|..
Zfish   323 DAARENREEILSRIRQAGF----------------------RVAMQKELML--TEEQVRLFYSTH 363

  Fly   148 DTTDVSSSVLMNELLAGPAISLELIGDNVVE----------TIKACAQYKSTEAETPSVKLSPSL 202
            ...:..:| ||..:.:|..::|.|:.:..||          .|||       :.|.|.     ||
Zfish   364 VEEEYFNS-LMENMTSGLVLALALVKEGAVEHWRNILGPKDPIKA-------KNEQPD-----SL 415

  Fly   203 EELFESEEIRYG-FYYSDNDNDVEMDLKFISEARHSIIKECVFKNTTLAIIKP---HSIKDGLLG 263
            ...|..|..... .:.|.:..:.|.::.|...           ...|||:|||   |.      .
Zfish   416 RAQFSVENSSINQLHGSSSSEEAEKEISFFFP-----------PEDTLAVIKPDTQHK------E 463

  Fly   264 DIISEILSNGFRLTAMRMILMARINCEEFYEVYRGVVPEYIPMVAQLASGVCMCMEIACADPEKK 328
            :|:.||.:.||.::.::..:::|...||||:.:| ..|.:..:|..:..|.|..:.:.    ::.
Zfish   464 EILEEIQAQGFTISQLKDTILSREMAEEFYKEHR-EKPFFSQLVDYMCRGPCTMLVLT----KEN 523

  Fly   329 TDREFRNFCGPMDPEIAKLLRPHTLRAKFGKSKVQNAVHCTDLPDDSNLELQYMF 383
            ..:|:|...||.||:.|:|..|.:|||:|.|..::||||.:...:.::.:::::|
Zfish   524 AVQEWRAAMGPTDPDQARLTAPESLRARFAKDVLENAVHGSSNTEHADQKIKFIF 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nmdyn-D7NP_649926.2 DM10 9..97 CDD:128921 4/13 (31%)
NDK 246..387 CDD:197791 41/141 (29%)
NDPk7B 246..383 CDD:239875 40/139 (29%)
nme9XP_021334262.1 TRX_NDPK 11..112 CDD:239246
NDPk_TX 161..296 CDD:239879
NDPk_TX 314..446 CDD:239879 31/159 (19%)
NDPk_TX 449..578 CDD:239879 40/139 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554381at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.