DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and SBA1

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_012805.1 Gene:SBA1 / 853743 SGDID:S000001600 Length:216 Species:Saccharomyces cerevisiae


Alignment Length:205 Identity:52/205 - (25%)
Similarity:80/205 - (39%) Gaps:41/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LIPPPVSWAQRNDLI-----YVIIDVECKDIEHKVTEKTFTFKGVNVLDPSK---------KYEV 57
            :|.|.|:||||:...     ||:|.|...|.:  ..|.|.....:.:...||         .|::
Yeast     5 VINPQVAWAQRSSTTDPERNYVLITVSIADCD--APELTIKPSYIELKAQSKPHVGDENVHHYQL 67

  Fly    58 TLNFLHEVDPEKVTSKNI-GRCLEFTIPKK-AAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEE 120
            .::...|:.|||...|.. |:.....:.|| ....||..||.:|.|..::|.:|.||.||.:.:|
Yeast    68 HIDLYKEIIPEKTMHKVANGQHYFLKLYKKDLESEYWPRLTKEKVKYPYIKTDFDKWVDEDEQDE 132

  Fly   121 GDQKDNSM-----FGNFLNSPGGDWNNKFDDFN----------------VDDEEEDSDDNIP--S 162
            .:.:.|..     |...:...||.......||:                :......|..|:.  .
Yeast   133 VEAEGNDAAQGMDFSQMMGGAGGAGGAGGMDFSQMMGGAGGAGSPDMAQLQQLLAQSGGNLDMGD 197

  Fly   163 LSQNDEDDEE 172
            ..:|||:|||
Yeast   198 FKENDEEDEE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 36/122 (30%)
SBA1NP_012805.1 p23_hB-ind1_like 8..129 CDD:107222 36/122 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346162
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 50 1.000 Inparanoid score I1842
Isobase 1 0.950 - 0 Normalized mean entropy S2530
OMA 1 1.010 - - QHG53619
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101574
Panther 1 1.100 - - LDO PTHR22932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 1 1.000 - - X1535
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.