DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and AT3G03773

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001154589.1 Gene:AT3G03773 / 821159 AraportID:AT3G03773 Length:204 Species:Arabidopsis thaliana


Alignment Length:166 Identity:43/166 - (25%)
Similarity:76/166 - (45%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPVSWAQRNDLIYVIIDV-ECKDIEHKV-TEKTFTFKGVNVLDPSKKYEVTLNFLHEVDPEKVTS 72
            |.|.||||:|.:|:.:.: :.|||..|. .:..|:|..:..  ..:::|.:|....::..|  ..
plant    59 PEVLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGA--QGERFEFSLELYGKIMTE--YR 119

  Fly    73 KNIG-RCLEFTIPKKAAGPYWSSLTTDKTK-LHFLKANFAKWRDESDD--EEGDQKDNSMFGNFL 133
            ||:| |.:.|:|.|:... :|:.|...:.| ..::|.::.||.||.::  .|....|.|.|    
plant   120 KNVGLRNIIFSIQKEERS-WWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASDDESAF---- 179

  Fly   134 NSPGGDWNNKFDDFNVDDEEEDSDDN----IPSLSQ 165
                           |:.:.|.|||:    :|.|.:
plant   180 ---------------VNQDSESSDDDGLLYLPDLEK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 32/110 (29%)
AT3G03773NP_001154589.1 p23_hB-ind1_like 59..165 CDD:107222 32/110 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I2643
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101574
Panther 1 1.100 - - LDO PTHR22932
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.