DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and Ptges3l

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001344503.1 Gene:Ptges3l / 73635 MGIID:1916146 Length:149 Species:Mus musculus


Alignment Length:155 Identity:35/155 - (22%)
Similarity:59/155 - (38%) Gaps:17/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPVSWAQRNDLIYVIIDVE-CKDI-----EHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDP 67
            |....|..|...:::...|| ..|:     :|:|........||.:.:       .:.|..:|:.
Mouse     5 PARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRVVFSCRNGDGVELYN-------EIEFYAKVNS 62

  Fly    68 EKVTSKNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNF 132
            :....|..||.:...:.|......|..||.:..|..:|..:|..|||...|:|.:......:...
Mouse    63 KDSQDKRSGRSITCFVRKWKEKVAWPRLTKEDIKPVWLSVDFDNWRDWEGDDEVELAQVEHYAEL 127

  Fly   133 LNSPGGDWNNKFDDFNVDDEEEDSD 157
            ||..    :.|.....:||.::|||
Mouse   128 LNKV----STKRPPPAMDDLDDDSD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 24/112 (21%)
Ptges3lNP_001344503.1 p23 5..110 CDD:107218 24/111 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3158
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5295
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.