DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and ptges3l

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001313640.1 Gene:ptges3l / 566751 ZFINID:ZDB-GENE-121214-210 Length:155 Species:Danio rerio


Alignment Length:167 Identity:39/167 - (23%)
Similarity:62/167 - (37%) Gaps:41/167 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPVSWAQRNDLI---YVI-------IDVE-------CKDIEHKVTEKTFTFKGVNVLDPSKKYE 56
            |....|..|...:   :|:       :||:       |||::..           |:.:..:.|:
Zfish    12 PAKTLWYDRKKYVTINFVVQNPKDVQVDVQDKKIILSCKDVDDN-----------NIYNEIEFYD 65

  Fly    57 VTLNFLHEVDP-EKVTSKNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEE 120
            ..|    :.|. |||..    |.:...|.|......|..|..|..|..:|..:|..|||...:||
Zfish    66 RVL----KADSREKVHD----RTINVLIRKVKENVAWPRLQKDTAKPAWLLVDFDNWRDWEHEEE 122

  Fly   121 GDQKDNSMFGNFLNSPGGDWNNKFDDFNVDDEEEDSD 157
            ....:...:.:.||    |..||.:...:||.::.||
Zfish   123 EGMAEYEQYVDMLN----DVKNKGEPPAMDDLDDLSD 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 27/124 (22%)
ptges3lNP_001313640.1 alpha-crystallin-Hsps_p23-like 12..117 CDD:294116 27/123 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594175
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5317
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.