DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and Ptges3

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_062740.1 Gene:Ptges3 / 56351 MGIID:1929282 Length:160 Species:Mus musculus


Alignment Length:158 Identity:43/158 - (27%)
Similarity:73/158 - (46%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPVSWAQRNDLIYVIIDVE-CKDIEHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDPEKVTS 72
            |....|..|.|.:::...|| .||:.....:...||..:...| :.|:...::..|.:||.....
Mouse     3 PASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSD-NFKHLNEIDLFHCIDPNDSKH 66

  Fly    73 KNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNFLNSPG 137
            |...|.:...:.|..:|..|..||.::.||::|..:|..|:|..||.:.|..:...|...::..|
Mouse    67 KRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMDHMG 131

  Fly   138 GDWNNKFDDFN-VDDEEEDSDD-NIPSL 163
            ||.:....:.: .||:.:|||| .:|.|
Mouse   132 GDEDVDLPEVDGADDDSQDSDDEKMPDL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 27/107 (25%)
Ptges3NP_062740.1 p23 3..109 CDD:107218 27/106 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 118..160 12/42 (29%)
PXLE motif. /evidence=ECO:0000250|UniProtKB:Q15185 157..160 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167848659
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5295
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53619
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 1 1.000 - - oto95338
orthoMCL 1 0.900 - - OOG6_101574
Panther 1 1.100 - - LDO PTHR22932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.