DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and ptges3

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001007105.1 Gene:ptges3 / 492275 XenbaseID:XB-GENE-943096 Length:160 Species:Xenopus tropicalis


Alignment Length:158 Identity:44/158 - (27%)
Similarity:73/158 - (46%) Gaps:4/158 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPVSWAQRNDLIYVIIDVE-CKDIEHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDPEKVTS 72
            |....|..|.|.::|...|| .|:::....:...||..:...| :.||...:.....:||.:...
 Frog     3 PASAKWYDRRDYVFVEFCVEDSKEVKTDFDKNKLTFSCLGGAD-NVKYLNEVELFQSIDPNESKH 66

  Fly    73 KNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNFLNSPG 137
            |...|.:...:.|..:|..|..:|.:|.||::|..:|..|:|..||.:.|..:...|...:|:.|
 Frog    67 KRTDRSVLCCLRKGESGQSWPRITKEKAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMG 131

  Fly   138 GDWNNKFDDFN-VDDEEEDSDD-NIPSL 163
            ||.:....:.: .||:..|||| .:|.|
 Frog   132 GDEDVDLPEVDGADDDSPDSDDEKMPDL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 27/107 (25%)
ptges3NP_001007105.1 p23 3..109 CDD:107218 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5122
OMA 1 1.010 - - QHG53619
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 1 1.000 - - oto105517
Panther 1 1.100 - - LDO PTHR22932
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.080

Return to query results.
Submit another query.