DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and ptges3a

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_998335.1 Gene:ptges3a / 406449 ZFINID:ZDB-GENE-040426-2200 Length:159 Species:Danio rerio


Alignment Length:175 Identity:43/175 - (24%)
Similarity:74/175 - (42%) Gaps:22/175 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PPPVSWAQRNDLIYVIIDVE-CKDIEHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDPEKVTS 72
            |....|..|.:.:::...:| .||::.|..:....|..|...| :.|:...::.|..:||.....
Zfish     3 PATAKWYDRREAVFIEFCIEDSKDVQVKFDKTKLDFSCVGGTD-NMKHHNEVDLLEAIDPNDSKH 66

  Fly    73 KNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNFLNSPG 137
            |...|.:...:.|...|..|..||.:|.||::|..:|..|:|..||.:.:......|...:|:.|
Zfish    67 KRTDRSVFCCLKKAEPGKSWPRLTKEKAKLNWLSVDFNNWKDWEDDSDEELSSFDRFSEMMNNMG 131

  Fly   138 GDWNNKFDDFNVDDEEEDSDDNIPSLSQNDEDDEEGGEGDKEKKP 182
            |                  :|::|.:  :..|:||..:.|.||.|
Zfish   132 G------------------EDDLPDV--DGADEEESPDSDDEKMP 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 27/107 (25%)
ptges3aNP_998335.1 alpha-crystallin-Hsps_p23-like 3..109 CDD:294116 27/106 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594173
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 70 1.000 Inparanoid score I5317
OMA 1 1.010 - - QHG53619
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 1 1.000 - - oto39154
orthoMCL 1 0.900 - - OOG6_101574
Panther 1 1.100 - - LDO PTHR22932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.