DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and Ptges3l1

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_001014294.1 Gene:Ptges3l1 / 367808 RGDID:1359350 Length:149 Species:Rattus norvegicus


Alignment Length:147 Identity:40/147 - (27%)
Similarity:70/147 - (47%) Gaps:6/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YVIID---VECKDIEHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDPEKVTSKNIGRCLEFTI 83
            ||.|:   ::.||:.....:...||..:...| :.|:...::..|.:||.....|.:.|.:...:
  Rat     3 YVCIEFCGLDSKDVNVNFEKFKLTFICIGGSD-NFKHLNEIDLFHSIDPNDSKHKRMDRSILCCL 66

  Fly    84 PKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNFLNSPGGDWNNKFDDFN 148
            .|..:...|..||.::.||::|..:|..|:|..||.|.|..:...|...::..|||.:....:.:
  Rat    67 RKAESDHSWPRLTKERAKLNWLSVDFNNWKDWEDDAEKDMSNFDRFSEMMDHMGGDEDADLPEVD 131

  Fly   149 -VDDEEEDSDD-NIPSL 163
             .||:.:|||| .:|.|
  Rat   132 GADDDSQDSDDEKMPDL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 24/97 (25%)
Ptges3l1NP_001014294.1 alpha-crystallin-Hsps_p23-like 3..98 CDD:412199 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5210
OMA 1 1.010 - - QHG53619
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22932
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.010

Return to query results.
Submit another query.