powered by:
Protein Alignment p23 and R10E4.9
DIOPT Version :9
Sequence 1: | NP_001247010.1 |
Gene: | p23 / 41173 |
FlyBaseID: | FBgn0037728 |
Length: | 184 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497864.1 |
Gene: | R10E4.9 / 187773 |
WormBaseID: | WBGene00011205 |
Length: | 202 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 20/73 - (27%) |
Similarity: | 27/73 - (36%) |
Gaps: | 22/73 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 FLHEVDPEKVTSKNIGRCLEFTIP------KKAA--------------GPYWSS--LTTDKTKLH 103
||.:.:|..|..:..||.|...:. |.|| |||:.| |.|....|.
Worm 61 FLTKSNPVAVFVQVSGRLLVLWVASHMVSWKYAAFSLVAVYLLSELCRGPYYLSNCLGTPNRSLT 125
Fly 104 FLKANFAK 111
:|:.|..|
Worm 126 WLRYNAFK 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1673 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.