DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and R10E4.9

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_497864.1 Gene:R10E4.9 / 187773 WormBaseID:WBGene00011205 Length:202 Species:Caenorhabditis elegans


Alignment Length:73 Identity:20/73 - (27%)
Similarity:27/73 - (36%) Gaps:22/73 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 FLHEVDPEKVTSKNIGRCLEFTIP------KKAA--------------GPYWSS--LTTDKTKLH 103
            ||.:.:|..|..:..||.|...:.      |.||              |||:.|  |.|....|.
 Worm    61 FLTKSNPVAVFVQVSGRLLVLWVASHMVSWKYAAFSLVAVYLLSELCRGPYYLSNCLGTPNRSLT 125

  Fly   104 FLKANFAK 111
            :|:.|..|
 Worm   126 WLRYNAFK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 20/73 (27%)
R10E4.9NP_497864.1 PTPLA 50..>148 CDD:295197 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.