DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and daf-41

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:NP_498126.1 Gene:daf-41 / 175727 WormBaseID:WBGene00022599 Length:175 Species:Caenorhabditis elegans


Alignment Length:182 Identity:68/182 - (37%)
Similarity:94/182 - (51%) Gaps:25/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PPVSWAQRNDLIYVIIDV-ECKDIEHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDPEKVTSK 73
            |.|.||||..|:|:.|:| |.|..|.|.......|:|.:..|   |||.||.|..|:||..|  |
 Worm     5 PTVLWAQRESLVYLTIEVDEAKIEELKGEGNKLHFQGSSKTD---KYEATLEFFDEIDPASV--K 64

  Fly    74 NIG---RCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNFLNS 135
            :.|   |.:|.|:.||... :|..|..:|.|:|:||.:|.||:||.:|:|.:.....:.|...| 
 Worm    65 HTGSSTRVVEITVQKKTPA-WWPRLLQNKGKVHWLKVDFGKWKDEDEDDEAEDAGAGIGGGMAN- 127

  Fly   136 PGGDWNNKFD--------DF-NVDDEEEDSDDNIPSLSQNDEDDEEGGEGDK 178
             |.|.|....        || .::|:||  ||::|.|..|:|  |||..|.:
 Worm   128 -GFDLNQYMSQMGGAGGADFGGLEDDEE--DDDMPDLEDNEE--EEGKNGTR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 46/110 (42%)
daf-41NP_498126.1 p23_hB-ind1_like 5..106 CDD:107222 43/106 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166471
Domainoid 1 1.000 44 1.000 Domainoid score I8380
eggNOG 1 0.900 - - E1_KOG3158
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 95 1.000 Inparanoid score I3632
Isobase 1 0.950 - 0 Normalized mean entropy S2530
OMA 1 1.010 - - QHG53619
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 1 1.000 - - oto18653
orthoMCL 1 0.900 - - OOG6_101574
Panther 1 1.100 - - LDO PTHR22932
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1673
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.