DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and Ptges3l

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_008766442.1 Gene:Ptges3l / 103693432 RGDID:9413039 Length:179 Species:Rattus norvegicus


Alignment Length:167 Identity:36/167 - (21%)
Similarity:62/167 - (37%) Gaps:27/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IPPPVS----------WAQRNDLIYVIIDVE-CKDI-----EHKVTEKTFTFKGVNVLDPSKKYE 56
            :|.|.|          |..|...:::...|| ..|:     :|::........||.:.:      
  Rat    24 LPSPTSNLFRQHARTLWYDRPKYVFMEFCVEDSTDVSVLIEDHRIVFSCRNGDGVELYN------ 82

  Fly    57 VTLNFLHEVDPEKVTSKNIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEG 121
             .:.|..:|:.:....|..||.:...:.|......|..||....|..:|..:|..|||...|:|.
  Rat    83 -EIEFYAKVNSKDSQDKRSGRSITCFVRKWKEKVPWPRLTKKDIKPVWLSVDFDNWRDWEGDDEM 146

  Fly   122 DQKDNSMFGNFLNSPGGDWNNKFDDFNVDDEEEDSDD 158
            :......:...||..    :.|.....:||.::|||:
  Rat   147 ELAQVEHYAELLNKV----STKRPPPAMDDLDDDSDN 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 25/122 (20%)
Ptges3lXP_008766442.1 p23 35..140 CDD:107218 22/111 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I5210
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22932
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.