DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment p23 and ptges3l

DIOPT Version :9

Sequence 1:NP_001247010.1 Gene:p23 / 41173 FlyBaseID:FBgn0037728 Length:184 Species:Drosophila melanogaster
Sequence 2:XP_012808237.1 Gene:ptges3l / 100127780 XenbaseID:XB-GENE-5738364 Length:149 Species:Xenopus tropicalis


Alignment Length:150 Identity:36/150 - (24%)
Similarity:67/150 - (44%) Gaps:15/150 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 WAQRNDLIYVIIDVE-CKDIEHKVTEKTFTFKGVNVLDPSKKYEVTLNFLHEVDP----EKVTSK 73
            |..|...:|:...|| .::::..:|::...|..:|. |..:.|. .:.....|.|    ||.:.:
 Frog     9 WYDRPKYVYLEFCVENSQNVKVDITKEKVIFSCLNE-DNIQIYN-EIQLYDAVQPLDSREKRSDR 71

  Fly    74 NIGRCLEFTIPKKAAGPYWSSLTTDKTKLHFLKANFAKWRDESDDEEGDQKDNSMFGNFLNSPGG 138
            :| .|....:.:|.|   |..:|.:..|..:|..:|..|||...:|||:......:.:.:||   
 Frog    72 SI-TCFLRKLKEKVA---WPRITKENHKPAWLFVDFDNWRDWDAEEEGEMAVAEHYLDLINS--- 129

  Fly   139 DWNNKFDDFNVDDEEEDSDD 158
             ..:|....::||.::..||
 Frog   130 -CKDKGAPPSMDDLDDLDDD 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
p23NP_001247010.1 p23_hB-ind1_like 10..117 CDD:107222 26/107 (24%)
ptges3lXP_012808237.1 p23 4..109 CDD:107218 25/105 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5122
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1461729at2759
OrthoFinder 1 1.000 - - FOG0001646
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1535
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.