DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl12 and F41C6.4

DIOPT Version :9

Sequence 1:NP_649924.1 Gene:Nepl12 / 41172 FlyBaseID:FBgn0037727 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001129930.1 Gene:F41C6.4 / 185599 WormBaseID:WBGene00018278 Length:393 Species:Caenorhabditis elegans


Alignment Length:336 Identity:65/336 - (19%)
Similarity:120/336 - (35%) Gaps:139/336 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EFMKSYMN---QSVEPCENFYEYAC--GNYRNVKPDRYSPGSRSNLGDVTYTLIDIT--EQLLGR 115
            :|.:..:|   ||.:||::||.:||  |:|..:...:|:|         .:..::.:  |.....
 Worm    20 DFFRDAINLIDQSSDPCDDFYRHACPVGDYDFLVLMKYAP---------IFKELETSQEESAWEN 75

  Fly   116 MDLAEALN------VSSEL-AVAQR-FYNACLGANLHPFNAADPAYLS-LIRS------------ 159
            :.:.||||      :.:|: |..:| |.:.|        ...|||..: |:|:            
 Worm    76 LKIEEALNNIKPGEIENEISAYFERVFLDMC--------QNNDPAMTTFLLRTQQMLSHEMSTKC 132

  Fly   160 --------IGGFPAVDGDAWKASNFNWINMSAHLANYGANGLIRETLQLRYPFEPYTKLPELGFD 216
                    :||    |.:..:|:|    :..:.:|        ::|....|.            :
 Worm   133 RAENCLLRLGG----DSNCTRAAN----DFKSRVA--------KKTDSSHYQ------------E 169

  Fly   217 HIIVHEENIS--RNTTRA--------FRLNEERMHGYL-------------------RAFGL--- 249
            :::...|||:  :|.|||        |::..:.::.:|                   ..|.|   
 Worm   170 YVLKLRENIAGWKNKTRAVNILLDGNFKVGVDNINSFLMNMVDVLLQWIQVYKYIAKNPFELILQ 234

  Fly   250 -----PEDRIREAIAGVFAFWRDALEIPPQCEVFDPYRIK-----RVFPQSEYYY---NISWSGL 301
                 .:.:|..|:..|.   ||..       |.|.|.|:     ....::|..:   :..:||.
 Worm   235 ETPWVNDQKINRALEAVA---RDLF-------VIDEYGIQLRENIDALMKTEQDFLKCSADFSGK 289

  Fly   302 HSTNKLFCDFY 312
            |.   |||..|
 Worm   290 HD---LFCSIY 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl12NP_649924.1 M13 68..700 CDD:189000 61/323 (19%)
F41C6.4NP_001129930.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11733
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.