DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nepl12 and nep-15

DIOPT Version :9

Sequence 1:NP_649924.1 Gene:Nepl12 / 41172 FlyBaseID:FBgn0037727 Length:702 Species:Drosophila melanogaster
Sequence 2:NP_001257056.2 Gene:nep-15 / 185513 WormBaseID:WBGene00018227 Length:267 Species:Caenorhabditis elegans


Alignment Length:229 Identity:64/229 - (27%)
Similarity:89/229 - (38%) Gaps:65/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 DNSINVMAGVVEPPIYQ----------RHLPISLKFGTLGFIVGHELIHGFDTTSS------YFD 544
            |:..|:||..::...|:          .|  |:|..|..||.||||:.|.|....|      ||.
 Worm    50 DSPRNLMATALKNLTYELRQKQADLFWNH--ITLVLGFTGFSVGHEIGHSFFANHSGTDILPYFS 112

  Fly   545 GN------GHMESLLSEISQQALEDRAECYMDYYGKYQVPEISRRVNGKTTLDENIADNSGLRQA 603
            .|      ....|..:|..:::...|.|                      .||:|.||..||:  
 Worm   113 ENVEKCVQNQFNSTCNEYKEESCVTRNE----------------------MLDDNGADIFGLQ-- 153

  Fly   604 LTAYRSHRQQLLEHPGQERISDAMPGLDLTPEQLFFLGFAQLFCS------HYEEEHYWKGLSDV 662
             .||:     |:|.....|:.:.:..|::|.|||||..||..|||      ..|||    |..|.
 Worm   154 -LAYK-----LMEKYLSGRLEERIERLNVTQEQLFFYSFANQFCSGSLSKVFIEEE----GDYDP 208

  Fly   663 HTFDQFRVLGVLSNSEDFFHAYNCSVGSGMRPGA 696
            |:.:..|| ..::....|..|:||...|.|...|
 Worm   209 HSVNNVRV-NAVAQHPGFRKAFNCPDNSRMMKSA 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nepl12NP_649924.1 M13 68..700 CDD:189000 64/229 (28%)
nep-15NP_001257056.2 GluZincin <87..237 CDD:387391 53/184 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.