DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fst and Mucl3

DIOPT Version :9

Sequence 1:NP_524294.2 Gene:Fst / 41169 FlyBaseID:FBgn0037724 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001003965.1 Gene:Mucl3 / 406199 RGDID:1303125 Length:470 Species:Rattus norvegicus


Alignment Length:247 Identity:59/247 - (23%)
Similarity:88/247 - (35%) Gaps:56/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ENGQGQSHGN-----------NQGLGQGNGHGNNHHGHHGNSHGHGNGQ--GHGGQRPPPP---- 117
            ::.:...:||           .:.|.....|....:....:.||..|.:  ..||.....|    
  Rat    99 DDAKAADYGNTTVGHEPFPASEKNLSSQGKHPMARNERSADDHGSTNSEKRSDGGHSTSAPMRKI 163

  Fly   118 ---PPTDLPELTTEDDVVSTTDVTSPAEETTLAPEVPEESTSQAPEEITTGSEEGSGSSEDTTTL 179
               |.|.          .|.|.|:|....|.|      .:|||.||.    |...|.....:|:|
  Rat   164 SCKPVTR----------TSGTPVSSTETSTKL------RTTSQKPET----SSHDSDLIRKSTSL 208

  Fly   180 APEVPEESTT--QAPEE---------STTDSEDGSGSEDTTQAPEETTTEEPEESTSEAPEESSS 233
            ..:..|.|.|  :.|..         .|:|.......|.|.:|....:|....|..:.:..|..|
  Rat   209 PVKSTEVSRTSYRTPRSLGAERHTIPFTSDKSIQLTIEHTKEATRSQSTPTKYERETRSASERIS 273

  Fly   234 EA---PEESTTEEPEESTTEAPVESTSEAPEESTTEAPEESTSEAPEESTID 282
            .|   |.|:.|....|:||:...:||... ||:||...|::| :|||..|::
  Rat   274 RAHVPPVENHTPSAGETTTQVSAKSTKHT-EEATTSTTEKAT-KAPERPTVN 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FstNP_524294.2 None
Mucl3NP_001003965.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 57..234 31/154 (20%)
MSS4 76..>293 CDD:227578 46/213 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..318 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E0DJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.