DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scm and Mbtd1

DIOPT Version :9

Sequence 1:NP_001247006.1 Gene:Scm / 41168 FlyBaseID:FBgn0003334 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_038943608.1 Gene:Mbtd1 / 688133 RGDID:1592427 Length:719 Species:Rattus norvegicus


Alignment Length:309 Identity:98/309 - (31%)
Similarity:146/309 - (47%) Gaps:39/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 DAYLEETGSEAAPAKCFKQAQNPPNND--FKIGMKLEALDPRNVTSTCIATVVGVLGSR-LRLRL 239
            |...::.|....|...|.:.:....:.  ||.||||||:||.|:::.|:||:..||... |.:.:
  Rat   382 DITKKQDGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGI 446

  Fly   240 DGS---DSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEEI 301
            |||   |..:.|.....|..|..:|.||.|...|.||.|:......|..||.:  ..::.||.::
  Rat   447 DGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRE--TGSIAAPVKL 509

  Fly   302 FQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDI 366
            |..:.|   .:.|:||.||||||...|:|||.|||..|....:.:.||||...:|.|.:..|.|:
  Rat   510 FNKDVP---NHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDL 571

  Fly   367 FPAGWCARSCHPMQPPGHKSRMD--SSSSKQR----------CPRPRYTVVAESEAMVPASPATA 419
            :|.|||..:.:.:|||..:|..:  |:||||:          ..:.|...|.:....:.:.|.| 
  Rat   572 YPVGWCQLTGYQLQPPASQSSRESQSASSKQKKKAKSQQYKGHKKKRKMPVGKKPVSLSSLPMT- 635

  Fly   420 HFHPNCKGG---PFINNSKLPCMVTGPTYQTL-AKLCLQEVLAASTDTQ 464
                   ||   .|..:.:|    |.|.|:|| |:..|:.....||..:
  Rat   636 -------GGVRRSFSGDEEL----TPPPYRTLPAQTALEAFPPPSTSRE 673

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScmNP_001247006.1 zf-FCS 55..95 CDD:283998
MBT 178..273 CDD:214723 33/100 (33%)
MBT <312..382 CDD:214723 30/69 (43%)
DUF3588 418..524 CDD:288954 14/51 (27%)
SAM_Scm 800..870 CDD:188977
SAM 806..867 CDD:197735
Mbtd1XP_038943608.1 MBT 172..272 CDD:214723
MBT 289..379 CDD:214723
MBT 386..483 CDD:214723 32/96 (33%)
MBT 495..587 CDD:214723 36/96 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.