DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scm and SCML1

DIOPT Version :9

Sequence 1:NP_001247006.1 Gene:Scm / 41168 FlyBaseID:FBgn0003334 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_005274635.1 Gene:SCML1 / 6322 HGNCID:10580 Length:330 Species:Homo sapiens


Alignment Length:162 Identity:51/162 - (31%)
Similarity:77/162 - (47%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   708 VHPEQANVKPSNSYYKSPTTLSSSASLPTSVSTPFTGCQSASSTALAAGGVTAAKAATAPAGAAA 772
            |||...:......||.|                  .|....||:.|..|...|.......:...|
Human   183 VHPSDFSEHNCQPYYAS------------------DGATYGSSSGLCLGNPRADSIHNTYSTDHA 229

  Fly   773 TAGASPSYTAITSPVSTPTSALANSHLRSQPIDWTIEEVIQYIESNDN-SLAVHGDLFRKHEIDG 836
            :| |.||.|  .|||.. ...:....:...|..|::|.|:.:::..|. :|....||||.|||||
Human   230 SA-APPSVT--RSPVEN-DGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDG 290

  Fly   837 KALLLLNSEMMMKYMGLKLGPALKICNLVNKV 868
            ||||||.|::::|::|:|||.|:|:|..::::
Human   291 KALLLLTSDVLLKHLGVKLGTAVKLCYYIDRL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScmNP_001247006.1 zf-FCS 55..95 CDD:283998
MBT 178..273 CDD:214723
MBT <312..382 CDD:214723
DUF3588 418..524 CDD:288954
SAM_Scm 800..870 CDD:188977 30/70 (43%)
SAM 806..867 CDD:197735 29/61 (48%)
SCML1XP_005274635.1 SAM_Scm 253..324 CDD:188977 30/70 (43%)
SAM 256..324 CDD:197735 30/67 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.