DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scm and SCML4

DIOPT Version :9

Sequence 1:NP_001247006.1 Gene:Scm / 41168 FlyBaseID:FBgn0003334 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_016866166.1 Gene:SCML4 / 256380 HGNCID:21397 Length:442 Species:Homo sapiens


Alignment Length:511 Identity:118/511 - (23%)
Similarity:188/511 - (36%) Gaps:174/511 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 PGH--KSRMDSS----SSKQRCPRPRYTVVAESEAMVP--ASP----ATAHFHPNCKGGPFINNS 434
            ||:  |||:..:    |..:..|.|..:.:.:..|.||  |:|    ...:.:.....||::...
Human    77 PGYKIKSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK 141

  Fly   435 KLPCMVT--GPTYQTLAKLCLQEVLAASTDTQQLSKLLFAL-----EGDVHIVTAA--GKNFTVK 490
            |:..:..  ||...:..   ||:.:.|..|.....||:|:|     .|::..|:|:  ||.....
Human   142 KVQQLPEHFGPERPSAV---LQQAVQACIDCAHQQKLVFSLVKQGYGGEMVSVSASFDGKQHLRS 203

  Fly   491 IPSPMRMKDDESLAQFIETLCTTCRA--CANLISLVHETEECKKCANSRKRQLTQSATPPSSPVL 553
            :|..      .|:...:..|...||:  |.:|.|  |:... :.|:.|.|.|             
Human   204 LPVV------NSIGYVLRFLAKLCRSLLCDDLFS--HQPFP-RGCSASEKVQ------------- 246

  Fly   554 ADKRNRQSNSATTSPSEKIIKQELAVKSPVESKSKTSTNNGKEPASQQNSNHSLNNNNNSASKSS 618
             :|...:..|..|..:|:.:...:.:                                       
Human   247 -EKEEGRMESVKTVTTEEYLVNPVGM--------------------------------------- 271

  Fly   619 NKVVIKSEPNGANAQTSSTTQALRKVRFQHHANTNTNSSATNGNQDTSQTTHVSTSHCSSSSTSS 683
                     |..:..||::|       |.|..:.:.:||.                :|...: |.
Human   272 ---------NRYSVDTSAST-------FNHRGSLHPSSSL----------------YCKRQN-SG 303

  Fly   684 STSLAGGSANTSTIGKYLAPLVAEVHPEQANVKPSNSYYKSPTTLSSSASLPTSVSTPFTGCQSA 748
            .:.|.||.|.|:. |...:|: :...|....::|             .||.|...:|...|.:.|
Human   304 DSHLGGGPAATAG-GPRTSPM-SSGGPSAPGLRP-------------PASSPKRNTTSLEGNRCA 353

  Fly   749 SSTALAAGGVTAAKAATAPAGAAATAGASPSYTAITSPVSTPTSALANSHLRSQPIDWTIEEVIQ 813
            |                           |||..|  .....|.|        ..|..||:|:|:.
Human   354 S---------------------------SPSQDA--QDARRPRS--------RNPSAWTVEDVVW 381

  Fly   814 YIESND-NSLAVHGDLFRKHEIDGKALLLLNSEMMMKYMGLKLGPALKICNLVNKV 868
            :::..| .:|..|.:|||||||||.|||||.|:|:|||:|||||||||:|..::|:
Human   382 FVKDADPQALGPHVELFRKHEIDGNALLLLKSDMVMKYLGLKLGPALKLCYHIDKL 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScmNP_001247006.1 zf-FCS 55..95 CDD:283998
MBT 178..273 CDD:214723
MBT <312..382 CDD:214723 118/511 (23%)
DUF3588 418..524 CDD:288954 26/116 (22%)
SAM_Scm 800..870 CDD:188977 38/70 (54%)
SAM 806..867 CDD:197735 36/61 (59%)
SCML4XP_016866166.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7837
eggNOG 1 0.900 - - E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123551at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.