DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scm and LOC100330797

DIOPT Version :9

Sequence 1:NP_001247006.1 Gene:Scm / 41168 FlyBaseID:FBgn0003334 Length:877 Species:Drosophila melanogaster
Sequence 2:XP_002666606.3 Gene:LOC100330797 / 100330797 -ID:- Length:355 Species:Danio rerio


Alignment Length:344 Identity:166/344 - (48%)
Similarity:202/344 - (58%) Gaps:60/344 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 FDWDAYLEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRL 239
            |.|:.||:||.|..||..||:|::.||:||||:||||||.||||.||||||||:|::|:||||||
Zfish    34 FSWEDYLKETASVPAPHSCFRQSRVPPSNDFKVGMKLEARDPRNSTSTCIATVMGLMGARLRLRL 98

  Fly   240 DGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEEIFQP 304
            ||||:.|||||||||.:|..||.|||||.||||||||||||||||.:|.:.||.|.:||...|:.
Zfish    99 DGSDNTNDFWRLVDSADIQPIGTCEKNGDMLQPPLGFRMNASSWPMFLLRTLNGAEMAPAMAFKK 163

  Fly   305 EPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPA 369
            ||..|.:|.|:.|.||||||:|||.|||.|||..:|.:::.|.||||||||||||.|.|||:||.
Zfish   164 EPLRPLQNTFRAGLKLEAVDRKNPYLICPATVGEVKGEELFVMFDGWRGAFDYWCRYDSRDLFPV 228

  Fly   370 GWCARSCHPMQPPGHKSRM-------DSSSSKQRCPRPRYTVVAESEAMVPASPATAHFHPNCKG 427
            |||:.:.|.:||||:...:       .||||..:..|..........|.|||.|..       ||
Zfish   229 GWCSATQHGLQPPGNSLGLPKAAPASSSSSSVPKLSRRSVLPPLRLPAAVPALPVR-------KG 286

  Fly   428 GPFINNSKLPCMVTG--PTYQTLAKLCLQEVLAASTDTQQLSKLLFALEGDVHIVTAAGKNFTVK 490
                        :.|  |..:|||                   ||.||       ||.|..    
Zfish   287 ------------IRGRRPKSETLA-------------------LLKAL-------TAPGAQ---- 309

  Fly   491 IPSPMRMKDDESLAQFIET 509
              ||..::|.....|.:.|
Zfish   310 --SPQELQDTPLSQQPLRT 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScmNP_001247006.1 zf-FCS 55..95 CDD:283998
MBT 178..273 CDD:214723 66/94 (70%)
MBT <312..382 CDD:214723 43/69 (62%)
DUF3588 418..524 CDD:288954 19/94 (20%)
SAM_Scm 800..870 CDD:188977
SAM 806..867 CDD:197735
LOC100330797XP_002666606.3 MBT 37..132 CDD:214723 66/94 (70%)
MBT 150..241 CDD:214723 52/90 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D123551at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.