DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SpdS and SMS

DIOPT Version :9

Sequence 1:NP_001247005.1 Gene:SpdS / 41167 FlyBaseID:FBgn0037723 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_016885242.1 Gene:SMS / 6611 HGNCID:11123 Length:369 Species:Homo sapiens


Alignment Length:242 Identity:72/242 - (29%)
Similarity:108/242 - (44%) Gaps:42/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WP---GQSFSLKVKEVIHKEKSRFQDIQIVETETYGRCLILDGIIQCTARDEFSYQEMI------ 72
            ||   |:.....:.||::.|.|.:|:|:|:.::.:|..|||.|.:. .|..:.:|...|      
Human   124 WPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVN-LAESDLAYTRAIMGSGKE 187

  Fly    73 SFLPLCAHPNPKKVLIVGGGDGGVAREVVK-HPLVEEVHQVEIDDRVVELSKQYLPAMACGFANE 136
            .:       ..|.|||:||||||:..|:|| .|  :.|..||||..|::..|:|: ...||...:
Human   188 DY-------TGKDVLILGGGDGGILCEIVKLKP--KMVTMVEIDQMVIDGCKKYM-RKTCGDVLD 242

  Fly   137 KLK-----LTIGDGFDYMK---KHKNEFDVIITD------SSDPIGPAVSLFQESYYELMKHALK 187
            .||     :.|.|....:|   |...|||.:|.|      |:.|...:...|.....:|....||
Human   243 NLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILDLSMKVLK 307

  Fly   188 DDGIVCSQGGSFWLD--LDYIKKTMSG--CKEHFAKVAYAVTSVPSY 230
            .||...:||....|.  |...::.:..  |...|:|   .:..||||
Human   308 QDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSK---EIVCVPSY 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpdSNP_001247005.1 AdoMet_MTases 1..283 CDD:302624 72/242 (30%)
SMSXP_016885242.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0421
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.