DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Calr and CALR

DIOPT Version :9

Sequence 1:NP_001262430.1 Gene:Calr / 41166 FlyBaseID:FBgn0005585 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_004334.1 Gene:CALR / 811 HGNCID:1455 Length:417 Species:Homo sapiens


Alignment Length:407 Identity:272/407 - (66%)
Similarity:321/407 - (78%) Gaps:7/407 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TVIVLLATVGFISAE--VYLKENF-DNENWEDTWIYSKHPGKEFGKFVLTPGTFYNDAEADKGIQ 67
            :|.:||..:|...||  ||.||.| |.:.|...||.|||. .:||||||:.|.||.|.|.|||:|
Human     4 SVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHK-SDFGKFVLSSGKFYGDEEKDKGLQ 67

  Fly    68 TSQDARFYAASRKFDGFSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDMHGESPYEIMF 132
            |||||||||.|..|:.|||:.:.|||||:|||||||||||||||||..|||||||||:|.|.|||
Human    68 TSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMF 132

  Fly   133 GPDICGPGTKKVHVIFSYKGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLE 197
            ||||||||||||||||:|||||.||:||||||||.:||.|||||||||||||.|||.:||||:||
Human   133 GPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLE 197

  Fly   198 DDWDFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKPEDWDDEMDGEWE 262
            ||||||.|||||||.|:||||||:||.|.||.|.||||||||||||||||.||||||:|||||||
Human   198 DDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWE 262

  Fly   263 PPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIF 327
            ||:|.|||:||||:|:|:|||:|||.|.||||.||||.||..:|.......||.|||||||||||
Human   263 PPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIF 327

  Fly   328 DNVLITDDVELAAKAAAEVKN-TQAGEKKMKEAQDEVQRKKDEEEAKKASDKDD-ED-EDDDDEE 389
            ||.|||:|...|.:...|... |:|.||:||:.|||.||.|:|||.||..:::: || |||:|::
Human   328 DNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKD 392

  Fly   390 KDDESKQDKDQSEHDEL 406
            :|:|.::||::.|.:::
Human   393 EDEEDEEDKEEDEEEDV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalrNP_001262430.1 Calreticulin 25..332 CDD:278680 229/307 (75%)
CALRNP_004334.1 N-domain 18..197 131/179 (73%)
Calreticulin 23..332 CDD:395201 230/309 (74%)
4 X approximate repeats 191..255 53/63 (84%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..278 69/84 (82%)
P-domain 198..308 85/109 (78%)
Interaction with PPIB. /evidence=ECO:0000250 237..270 28/32 (88%)
3 X approximate repeats 259..297 27/37 (73%)
C-domain 309..417 49/101 (49%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..417 28/60 (47%)
Prevents secretion from ER 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 383 1.000 Domainoid score I830
eggNOG 1 0.900 - - E1_KOG0674
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37911
Inparanoid 1 1.050 570 1.000 Inparanoid score I1063
Isobase 1 0.950 - 0 Normalized mean entropy S1196
OMA 1 1.010 - - QHG53836
OrthoDB 1 1.010 - - D351852at33208
OrthoFinder 1 1.000 - - FOG0002317
OrthoInspector 1 1.000 - - oto91670
orthoMCL 1 0.900 - - OOG6_102266
Panther 1 1.100 - - LDO PTHR11073
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R163
SonicParanoid 1 1.000 - - X1529
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.820

Return to query results.
Submit another query.