DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Calr and CG1924

DIOPT Version :9

Sequence 1:NP_001262430.1 Gene:Calr / 41166 FlyBaseID:FBgn0005585 Length:406 Species:Drosophila melanogaster
Sequence 2:NP_572788.2 Gene:CG1924 / 32180 FlyBaseID:FBgn0030377 Length:570 Species:Drosophila melanogaster


Alignment Length:350 Identity:127/350 - (36%)
Similarity:185/350 - (52%) Gaps:47/350 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 DKGIQTSQDARFYAAS----RKFDGFSNEDKPLVVQFSVKHEQNIDCGGGYVKLFDCSLDQTDM- 122
            |.|:.....|:..|.:    :.|| |.:| ||||||:.:..::..:|||.|:||.....:...: 
  Fly   118 DLGLVLKSKAKHAAIAAHLHQPFD-FKSE-KPLVVQYEITIQKGQECGGSYLKLLSAGKETEQLQ 180

  Fly   123 --HGESPYEIMFGPDICGPGTKKVHVIFSYKGKNHLISKDIRCK----------DDVYTHFYTLI 175
              :.::||.||||||.||... .:|.||.:....:....:..|.          .|...|.|.|:
  Fly   181 TFNDKTPYTIMFGPDKCGKDV-TIHFIFKHVNPINGTITEKHCNKPNNSFEEPFKDKLPHLYQLV 244

  Fly   176 VRPDNTYEVLIDNEKVESGNLEDDW--DFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDK 238
            |||||::|:.||::.::.|:|..|:  ....|.:|.||...||:.||:|..||||...||||||:
  Fly   245 VRPDNSFEIRIDHKIIKEGSLLTDFKPPVNPPAEIDDPNDHKPDSWDEREKIPDPTVHKPEDWDE 309

  Fly   239 PEHIP--------DPDATKPEDWDDEMDGEWEPPMID--------------NPEFKGEWQPKQLD 281
            .|.:.        ||.||||||||||:||||:.||:|              ||.:||:|....:|
  Fly   310 NETLKLPDADMIFDPTATKPEDWDDEIDGEWQAPMVDNPVCKKDQTCGIIRNPNYKGKWIAPMID 374

  Fly   282 NPNYKGAWEHPEIANPEYVPDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAA-- 344
            ||||:|.|...:||||::..|.|.:....|..:|.:||.:.|..:|||::||||||:|...||  
  Fly   375 NPNYQGKWAPRKIANPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANS 439

  Fly   345 -EVKNTQAGEKKMKEAQDEVQRKKD 368
             ::|......::.......|:..||
  Fly   440 FDIKRRYIDRERDSIVNKVVELVKD 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CalrNP_001262430.1 Calreticulin 25..332 CDD:278680 114/309 (37%)
CG1924NP_572788.2 Calreticulin 70..425 CDD:278680 114/309 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1196
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46798
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11073
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.