DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8319 and AZF1

DIOPT Version :9

Sequence 1:	NP_649920.2	Gene:	CG8319 / 41165	FlyBaseID:	FBgn0037722	Length:	383	Species:	Drosophila melanogaster
Sequence 2:	NP_014756.3	Gene:	AZF1 / 854280	SGDID:	S000005639	Length:	914	Species:	Saccharomyces cerevisiae

Alignment Length:	134	Identity:	45/134 - (33%)
Similarity:	67/134 - (50%)	Gaps:	8/134 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   250 KAHLLIHAESKQGN------GPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQA 308
            |:.|:...|..:|.      ..|:|.||...|...:.|:||:.:|:|.:|..|.:|...|.....
Yeast   571 KSELVGGVEKPKGTQNTRAVKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGN 635

  Fly   309 LKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSI--CLQDFREKHHLKRHFLG 371
            |:.|.|:|||||||.|..|.|.||...|||.|...|...:|:.|.:  |.:.|.:..::|.|...
Yeast   636 LRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNR 700

  Fly   372 KHRD 375
            .|::
Yeast   701 FHKE 704

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8319	NP_649920.2	zf-AD	4..79	CDD:285071
		COG5048	<153..368	CDD:227381	43/125 (34%)
		C2H2 Zn finger	153..173	CDD:275368
		C2H2 Zn finger	179..196	CDD:275368
		C2H2 Zn finger	207..227	CDD:275370
		C2H2 Zn finger	236..256	CDD:275368	2/5 (40%)
		C2H2 Zn finger	268..288	CDD:275368	7/19 (37%)
		C2H2 Zn finger	296..316	CDD:275368	6/19 (32%)
		zf-H2C2_2	308..332	CDD:290200	13/23 (57%)
		zf-C2H2	322..344	CDD:278523	10/21 (48%)
		C2H2 Zn finger	324..344	CDD:275368	9/19 (47%)
		C2H2 Zn finger	352..368	CDD:275368	4/17 (24%)
AZF1	NP_014756.3	COG5048	342..768	CDD:227381	45/134 (34%)
		C2H2 Zn finger	595..615	CDD:275368	7/19 (37%)
		C2H2 Zn finger	623..643	CDD:275368	6/19 (32%)
		C2H2 Zn finger	651..671	CDD:275368	9/19 (47%)
		C2H2 Zn finger	679..702	CDD:275368	5/22 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100