DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and ZNF121

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001008727.1 Gene:ZNF121 / 7675 HGNCID:12904 Length:390 Species:Homo sapiens


Alignment Length:266 Identity:82/266 - (30%)
Similarity:124/266 - (46%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 IKKTHQTASRTTKSSIT---TSRAGRQLR-------SIKNQT----FKCELCIKQFKRQINLLDH 169
            :.::|..|:|.|.:..|   ..:.||...       |:|..|    ::|:.|.|.|:....|..|
Human    98 VDQSHLQANRITHNGETLYEQKQCGRAFTYSTSHAVSVKMHTVEKPYECKECGKFFRYSSYLNSH 162

  Fly   170 MKVHSNS--HVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERS 232
            |:.|:..  :.|:.|.:.|...:.|..|..........:|.||.:.|:....|..|......|: 
Human   163 MRTHTGEKPYECKECGKCFTVSSHLVEHVRIHTGEKPYQCKECGRAFAGRSGLTKHVRIHTGEK- 226

  Fly   233 PFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACP 297
            |::|..|.:|:.|...|..|...|.|.|    |.:|..|...|.:.|.||.|...|.|.:|:.|.
Human   227 PYECNECGKAYNRFYLLTEHFKTHTEEK----PFECKVCGKSFRSSSCLKNHFRIHTGIKPYKCK 287

  Fly   298 FCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREK 362
            .|...|....:|..|::||||||||:|..|.|.|:.::.|.:|.|.|:.|:||.|..|.:.||..
Human   288 ECGKAFTVSSSLHNHVKIHTGEKPYECKDCGKAFATSSQLIEHIRTHTGEKPYICKECGKTFRAS 352

  Fly   363 HHLKRH 368
            .||::|
Human   353 SHLQKH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071
COG5048 <153..368 CDD:227381 71/216 (33%)
C2H2 Zn finger 153..173 CDD:275368 7/19 (37%)
C2H2 Zn finger 179..196 CDD:275368 4/16 (25%)
C2H2 Zn finger 207..227 CDD:275370 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
zf-H2C2_2 308..332 CDD:290200 13/23 (57%)
zf-C2H2 322..344 CDD:278523 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 6/15 (40%)
ZNF121NP_001008727.1 C2H2 Zn finger 65..82 CDD:275368
COG5048 <85..270 CDD:227381 44/176 (25%)
C2H2 Zn finger 91..110 CDD:275368 3/11 (27%)
C2H2 Zn finger 119..138 CDD:275368 4/18 (22%)
zf-C2H2 144..166 CDD:278523 7/21 (33%)
C2H2 Zn finger 146..166 CDD:275368 7/19 (37%)
zf-H2C2_2 158..182 CDD:290200 6/23 (26%)
C2H2 Zn finger 174..194 CDD:275368 5/19 (26%)
zf-H2C2_2 186..210 CDD:290200 5/23 (22%)
C2H2 Zn finger 202..222 CDD:275368 6/19 (32%)
zf-H2C2_2 215..239 CDD:290200 7/24 (29%)
COG5048 <226..388 CDD:227381 52/138 (38%)
C2H2 Zn finger 230..250 CDD:275368 6/19 (32%)
zf-H2C2_2 243..267 CDD:290200 9/27 (33%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
zf-H2C2_2 271..294 CDD:290200 8/22 (36%)
C2H2 Zn finger 286..306 CDD:275368 5/19 (26%)
zf-H2C2_2 301..323 CDD:290200 13/21 (62%)
C2H2 Zn finger 314..334 CDD:275368 7/19 (37%)
zf-H2C2_2 327..349 CDD:290200 9/21 (43%)
C2H2 Zn finger 342..362 CDD:275368 7/17 (41%)
zf-H2C2_2 354..379 CDD:290200 3/5 (60%)
C2H2 Zn finger 370..390 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3885
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.