DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and ZNF84

DIOPT Version :10

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_003419.3 Gene:ZNF84 / 7637 HGNCID:13159 Length:738 Species:Homo sapiens


Alignment Length:325 Identity:99/325 - (30%)
Similarity:157/325 - (48%) Gaps:34/325 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VHDARTAYGFKRRCEENYKKF--YLAILNGQVIKDEPNEEDFLFIENPDKGNLEAKKKLNKEIKK 121
            :|.....|    .|.|..|.|  ..:::|.|  :....|:        ..|.::..|..:::...
Human   396 IHTGEKPY----ECSECRKAFRERSSLINHQ--RTHTGEK--------PHGCIQCGKAFSQKSHL 446

  Fly   122 THQTASRTTKSSITTSRAG----RQLRSIKNQ-------TFKCELCIKQFKRQINLLDHMKVHSN 175
            .....:.|.:.....|:.|    |:.:.:::|       .::|..|.|.|..:::|.:|.::|:.
Human   447 ISHQMTHTGEKPFICSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHTG 511

  Fly   176 S--HVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCKDMQERSPFQCPH 238
            .  :||..|.:.|..|:.|.:||.........||.||.|.|....||.:|:.....|: |::|..
Human   512 EKPYVCSECGKAFCQKSHLISHQRTHTGEKPYECSECGKAFGEKSSLATHQRTHTGEK-PYECRD 575

  Fly   239 CQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNF 303
            |::||:::..|..|..||.    |..|::||.|:..||.||.|..|:..|.||:|:.|..|...|
Human   576 CEKAFSQKSQLNTHQRIHT----GEKPYECSLCRKAFFEKSELIRHLRTHTGEKPYECNECRKAF 636

  Fly   304 RSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRH 368
            |.|.:|..|.||||||||::|..|.|.||..::|..|:|.|:.|:||.||.|.:.|.:|..|..|
Human   637 REKSSLINHQRIHTGEKPFECSECGKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVNH 701

  Fly   369  368
            Human   702  701

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:462262 5/19 (26%)
COG5048 <153..368 CDD:227381 82/216 (38%)
C2H2 Zn finger 153..173 CDD:275368 6/19 (32%)
C2H2 Zn finger 179..196 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..227 CDD:275370 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 9/19 (47%)
C2H2 Zn finger 296..316 CDD:275368 8/19 (42%)
C2H2 Zn finger 324..344 CDD:275368 8/19 (42%)
C2H2 Zn finger 352..368 CDD:275368 6/15 (40%)
ZNF84NP_003419.3 KRAB 9..68 CDD:214630
C2H2 Zn finger 209..229 CDD:275368
C2H2 Zn finger 237..257 CDD:275368
zf-C2H2 263..285 CDD:395048
C2H2 Zn finger 265..285 CDD:275368
zf-H2C2_2 278..302 CDD:463886
C2H2 Zn finger 293..313 CDD:275368
COG5048 317..724 CDD:227381 99/325 (30%)
C2H2 Zn finger 321..341 CDD:275368
C2H2 Zn finger 349..369 CDD:275368