DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and sens

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster


Alignment Length:464 Identity:103/464 - (22%)
Similarity:169/464 - (36%) Gaps:124/464 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GAKLAEMV-KTCADV---QLDPDDAM-PQKMCISCVHDARTAYGFKRRCEENYKKFYL-----AI 83
            |..|..|. |:.|.|   |.|.|.|: |:|     .|:.:     .....||.|:.|.     ..
  Fly    82 GTPLTPMTPKSPASVVLGQRDRDFALTPEK-----EHELQ-----MNNNNENSKQDYQEQDEDMP 136

  Fly    84 LN----GQVIKDEPNEEDFLFIENPDKGNLEAKKKLNKEIKKTH--------------------- 123
            ||    .::..|:.|.:.:     ....|..::...:.|:::.|                     
  Fly   137 LNLSTKERITSDDSNRDQY-----HSSSNNSSRSSSSSEVEQLHPMTSLNVTPPPLSAVNLKSSS 196

  Fly   124 --QTASRTTKSSITTSRAGRQLRSIKNQTFKCEL-------------CIKQFK--RQINLLDHMK 171
              |...:.::.:|..|.|....||.:.:.:..::             .:::||  |:...:..::
  Fly   197 TPQQQRQRSQGNIIWSPASMCERSARREQYGLKMEEQGDEEEHQVDPIVRKFKYERRTASISSLQ 261

  Fly   172 --VHSNSHVCQNCEERFLFKADLDNHQCYRNS-------NSTVECPECLKVFSS--TQSLDSHKC 225
              :.|.|....|..:...|:........:|::       |:.....:.||:.|.  .|....|:.
  Fly   262 SPISSLSAPASNAVQDLEFEVAQQQLYAHRSAFMAGLTGNNLELLTQHLKLKSEQPQQQQQQHRI 326

  Fly   226 KDMQE---------------------RSPFQCP--------HCQQAFTREQNLKAH--------- 252
            ||.|:                     |:..|.|        |.||...:.|:.:.|         
  Fly   327 KDEQQQDNRSAAALMNLVAAAEFGYMRNQHQQPQQQQQQQLHHQQQPQQHQHQQQHPDSTATDVA 391

  Fly   253 -LLIHAESKQGNGPHK-------CSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQAL 309
             ....:.|.||....|       |..|...|...|.|..|:..|...||:.|.:|...|..|..:
  Fly   392 RRSSSSSSYQGENEEKRSGRNFQCKQCGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDM 456

  Fly   310 KVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRHFLGKHR 374
            |.|..|||||||::|..|.|.||.::||..|.|:|:..:|:.|.:|.|.|:.|..|:||...:|.
  Fly   457 KKHTYIHTGEKPHKCTVCLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHRESRHE 521

  Fly   375 DGDQKLKLK 383
            :......||
  Fly   522 EAPPVEDLK 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 16/54 (30%)
COG5048 <153..368 CDD:227381 68/286 (24%)
C2H2 Zn finger 153..173 CDD:275368 3/36 (8%)
C2H2 Zn finger 179..196 CDD:275368 2/16 (13%)
C2H2 Zn finger 207..227 CDD:275370 5/21 (24%)
C2H2 Zn finger 236..256 CDD:275368 6/37 (16%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
zf-H2C2_2 308..332 CDD:290200 12/23 (52%)
zf-C2H2 322..344 CDD:278523 9/21 (43%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
C2H2 Zn finger 352..368 CDD:275368 6/15 (40%)
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 6/21 (29%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
COG5048 423..>497 CDD:227381 29/73 (40%)
zf-H2C2_2 428..452 CDD:290200 8/23 (35%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)
zf-H2C2_2 455..480 CDD:290200 13/24 (54%)
C2H2 Zn finger 471..491 CDD:275368 9/19 (47%)
C2H2 Zn finger 499..516 CDD:275368 7/16 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.