DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and CG31365

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:608 Identity:116/608 - (19%)
Similarity:180/608 - (29%) Gaps:272/608 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LCRICGGASENMLGIFDDQVEEYVDGAKLAEMVKTCADVQLD--PDDAMPQKMCISCVHDARTAY 66
            |||:|....::...|||:      |..:|:..|:..|.|.||  ..|.:|:::|..|.:....::
  Fly    13 LCRLCLKEHQDAYAIFDE------DDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSF 71

  Fly    67 GFKRRCEENYKKF--YLAIL----NGQVIKDEPN---------EEDFLFIENPD----------- 105
            .|::||:...||.  ::.:|    ..:|...:|:         |:...|||..|           
  Fly    72 LFRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWR 136

  Fly   106 ----------------KGNLEAKKKLNKEIKK--THQTASRTTKS-------------------- 132
                            |..||.:.||..|::|  ..:..|...|.                    
  Fly   137 EDFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVRDDLRNEVSED 201

  Fly   133 ---------------SITTSRAGR-------------QLR------------------SIKNQTF 151
                           .:|..:|||             |::                  |:.:...
  Fly   202 IRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDANL 266

  Fly   152 KCELCIKQFK-------------------------------------RQINLLDHMKVHSNSHVC 179
            |.....|..|                                     |:||::....||:     
  Fly   267 KATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHT----- 326

  Fly   180 QNCEERFLFKADLDNHQCY---------RNSNSTVECPECLKVFSSTQSLDSHKCK--------- 226
                         ||.:.|         :|.:||.|       |.....:.|:..|         
  Fly   327 -------------DNGEIYIINSASSEDQNQDSTPE-------FDQDNGITSYNIKEDGEIQFSG 371

  Fly   227 ---------------------------------------DMQERSP------------------- 233
                                                   |..|::|                   
  Fly   372 EKPEEIEDVVVFNLGEEISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQ 436

  Fly   234 ------------FQCPHCQQAFTREQNLKAHLLIHAES-KQG-NGPHKCSYCQTGFFNKSALKVH 284
                        |||..|..||..::.|..|...|.:. |.| .|..||..|.......|:||.|
  Fly   437 PKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRH 501

  Fly   285 IHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKH--RRRHSDE 347
            :..|.|.:|..|..|..:|..::.||.|:..|||.|.:|||.|...|:..:||.:|  |....:.
  Fly   502 MIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNS 566

  Fly   348 RPYKCSICLQDFREKHHLKRHFL 370
            |.:||.:|.:.|.....|.||.:
  Fly   567 RTHKCHLCHRSFNHVSGLSRHLV 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 22/76 (29%)
COG5048 <153..368 CDD:227381 67/343 (20%)
C2H2 Zn finger 153..173 CDD:275368 5/56 (9%)
C2H2 Zn finger 179..196 CDD:275368 2/16 (13%)
C2H2 Zn finger 207..227 CDD:275370 3/67 (4%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 6/19 (32%)
C2H2 Zn finger 296..316 CDD:275368 6/19 (32%)
zf-H2C2_2 308..332 CDD:290200 11/23 (48%)
zf-C2H2 322..344 CDD:278523 9/23 (39%)
C2H2 Zn finger 324..344 CDD:275368 8/21 (38%)
C2H2 Zn finger 352..368 CDD:275368 4/15 (27%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 23/78 (29%)
vATP-synt_E 109..>244 CDD:304907 19/134 (14%)
RRF <161..222 CDD:294170 7/60 (12%)
zf-C2H2_8 454..530 CDD:292531 24/75 (32%)
C2H2 Zn finger 485..505 CDD:275368 6/19 (32%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 6/19 (32%)
zf-H2C2_2 526..550 CDD:290200 12/23 (52%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 571..591 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.