DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and topi

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster


Alignment Length:483 Identity:114/483 - (23%)
Similarity:166/483 - (34%) Gaps:155/483 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CRIC-------GGASENM----LGIFDDQVEEY---VDGAKLAEMVK--TCADVQLDPDDAMPQK 53
            |.:|       .|...:|    |.:...|..|.   :..|.|..:||  :|..:..||..|....
  Fly   230 CTMCDRKFVHASGLVRHMEKHALDLIPSQTSEQPHTIPAAGLHVVVKCNSCGRIFYDPQVAFRHG 294

  Fly    54 MCISCVHDARTAYGFKR-----RCEENYKKFYLAILNGQVIKDEPNEEDFLFIE---NPDKGNLE 110
            :    :||:.  :...|     :...|...|...:|:|:::.|  |:..|....   ||.|    
  Fly   295 L----IHDSE--HSTMRQSPMTQVPSNRADFNELLLDGEMLID--NDPAFATSNQNTNPPK---- 347

  Fly   111 AKKKLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQINLLDHMKVHSN 175
                  ||:           .||:           |.....:||.|...|.....||    |||.
  Fly   348 ------KEM-----------FSSL-----------ILGSVLQCEFCEYIFADIAELL----VHSA 380

  Fly   176 SHV------CQNC--------EERFLFKAD-LDNHQCYRNSNSTVE----CPECLKVFSSTQSLD 221
            |||      |..|        |....|:.| :...:..|:.|.|:.    |..|...|::|..|.
  Fly   381 SHVAERRFECTACDIQMNTAKEASIHFQTDCIFMREAIRSLNVTLSRYFVCNVCELKFANTDLLQ 445

  Fly   222 SHKC-------------------------------------------KDMQERS----------P 233
            .|:|                                           |..:|:.          .
  Fly   446 EHRCTSFHYFPRLNENGKKLLLPCDFCDVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQ 510

  Fly   234 FQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKC--SYCQTGFFNKSALKVHIH-AHMGERPHA 295
            :.|..|.:::|:..:|..||..|    ||..|..|  ..|...|..:..|..||. .|.||||:.
  Fly   511 YLCDICGKSYTQSSHLWQHLRFH----QGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYL 571

  Fly   296 CPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICLQDF- 359
            |..|...|.:......|..||.||:.|:|..|.|.|...:.|..|:|.|:.|:||.|..|.:.| 
  Fly   572 CLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRIHTGEKPYSCLFCTKTFR 636

  Fly   360 ----REKHHLKRHFLGKHRDGDQKLKLK 383
                |:||...||   .|.|.:.:|.::
  Fly   637 QRGDRDKHIRARH---SHLDANSRLMMQ 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 19/94 (20%)
COG5048 <153..368 CDD:227381 76/294 (26%)
C2H2 Zn finger 153..173 CDD:275368 6/19 (32%)
C2H2 Zn finger 179..196 CDD:275368 5/25 (20%)
C2H2 Zn finger 207..227 CDD:275370 7/62 (11%)
C2H2 Zn finger 236..256 CDD:275368 6/19 (32%)
C2H2 Zn finger 268..288 CDD:275368 6/22 (27%)
C2H2 Zn finger 296..316 CDD:275368 4/19 (21%)
zf-H2C2_2 308..332 CDD:290200 9/23 (39%)
zf-C2H2 322..344 CDD:278523 8/21 (38%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..368 CDD:275368 6/20 (30%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368 4/19 (21%)
C2H2 Zn finger 277..297 CDD:275368 4/23 (17%)
C2H2 Zn finger 431..453 CDD:275368 7/21 (33%)
COG5048 <450..647 CDD:227381 49/200 (25%)
C2H2 Zn finger 469..490 CDD:275368 0/20 (0%)
zf-C2H2 511..533 CDD:278523 6/21 (29%)
C2H2 Zn finger 513..564 CDD:275368 16/54 (30%)
C2H2 Zn finger 541..561 CDD:275368 5/19 (26%)
zf-H2C2_2 555..581 CDD:290200 11/25 (44%)
C2H2 Zn finger 572..592 CDD:275368 4/19 (21%)
zf-H2C2_2 585..609 CDD:290200 10/23 (43%)
zf-C2H2 598..620 CDD:278523 8/21 (38%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 612..637 CDD:290200 10/24 (42%)
C2H2 Zn finger 628..646 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.