DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and M1BP

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster


Alignment Length:427 Identity:97/427 - (22%)
Similarity:162/427 - (37%) Gaps:82/427 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDLCRICGGASENMLG--IFDDQVEEYVDGAKLAEMVKTCADVQLDPDDAMPQKMCISCVHDAR 63
            ::..||:|...:.|...  :|:.      ...|:.:.::....::|:....:|.::|..|..:..
  Fly     9 LKSTCRVCAKYASNKRSPKLFER------SNTKMIDNIEALTGLRLENYGCLPDQICECCSMELA 67

  Fly    64 TAYGFKRRC---------------EENYKKFYLAILNG----QVIKDEPNEEDF-----LFIENP 104
            :|...:.||               .:....||.|.:.|    |.:|...::|.:     :.:|.|
  Fly    68 SAVKLRERCIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEP 132

  Fly   105 DKGNLEAKKKLNKEIKKTHQTASRTTKSSITTSRAGRQ--LRSIKNQTFKCELCIKQFKRQINLL 167
                       .:||..| :.....|...:....||..  ...|:...:...:...:.::|...|
  Fly   133 -----------KEEIDDT-KVEYDNTYYEVAEGHAGEDDAASLIEEADYDSIMAEDEEQQQTLEL 185

  Fly   168 DHMKVHSNSHVCQNCEERFLFKAD-----LDN--HQCYRNSNSTV-EC--PECLKVFSSTQSLDS 222
            |    .....:..:..:.:::.:|     |||  ...|.:.|..| :|  |...||.|.      
  Fly   186 D----EDTELIVGDVNDAYVYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKPKVRSD------ 240

  Fly   223 HKCKDMQERSP---FQCPHCQQAFTREQNLKAHLL--IHAESKQGNGPHKCSYCQTGFFNKSALK 282
                |.:.|..   :.|..|      ..::|..:.  :|....:|:....|..||:.|...|.||
  Fly   241 ----DARRRGTGGVYICEQC------GNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELK 295

  Fly   283 VHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDE 347
            .|:..|.||||.||.:|...|........|.|.||.|:||.|..|.|.|:....|..|...||.|
  Fly   296 RHMRKHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGE 360

  Fly   348 RPYKCSICLQDFREKHHLKRHF-LGKHRDGDQKLKLK 383
            |.|:|.:|.:.|....||..|| .|.|:...:|.::|
  Fly   361 RAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 13/91 (14%)
COG5048 <153..368 CDD:227381 62/229 (27%)
C2H2 Zn finger 153..173 CDD:275368 3/19 (16%)
C2H2 Zn finger 179..196 CDD:275368 4/23 (17%)
C2H2 Zn finger 207..227 CDD:275370 5/21 (24%)
C2H2 Zn finger 236..256 CDD:275368 3/21 (14%)
C2H2 Zn finger 268..288 CDD:275368 8/19 (42%)
C2H2 Zn finger 296..316 CDD:275368 5/19 (26%)
zf-H2C2_2 308..332 CDD:290200 10/23 (43%)
zf-C2H2 322..344 CDD:278523 7/21 (33%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 352..368 CDD:275368 5/15 (33%)
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 13/76 (17%)
C2H2 Zn finger 253..273 CDD:275368 4/25 (16%)
COG5048 276..>331 CDD:227381 20/54 (37%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
zf-H2C2_2 293..317 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 5/19 (26%)
zf-H2C2_2 324..346 CDD:290200 11/21 (52%)
C2H2 Zn finger 337..357 CDD:275368 6/19 (32%)
zf-H2C2_2 350..372 CDD:290200 9/21 (43%)
C2H2 Zn finger 365..383 CDD:275368 6/17 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3885
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.