DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and ZNF662

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001128128.1 Gene:ZNF662 / 389114 HGNCID:31930 Length:452 Species:Homo sapiens


Alignment Length:337 Identity:101/337 - (29%)
Similarity:146/337 - (43%) Gaps:71/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 FKRRCEENYK-KFYLAILNGQVIKDEPNE-------EDFLFIE----NPDKGNLEA--KKKLNKE 118
            |.:.|||..: ..:...|||..::...|:       ::.:.:|    |.|..||..  .|.||::
Human   151 FGKTCEEKSRLGRWPGYLNGGRMESSTNDIIEVIVKDEMISVEESSGNTDVNNLLGIHHKILNEQ 215

  Fly   119 I--------------------KKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQ 163
            |                    :|||.                      ..:.:.|:.|.|.|..:
Human   216 IFYICEECGKCFDQNEDFDQHQKTHN----------------------GEKVYGCKECGKAFSFR 258

  Fly   164 INLLDHMKVHS--NSHVCQNCEERFLFKADLDNHQCYRNSNSTVECPECLKVFSSTQSLDSHKCK 226
            .:.:.|.::||  ..:.||.|.:.|::|::|..||.........||.||.|.||...||..|:..
Human   259 SHCIAHQRIHSGVKPYECQECAKAFVWKSNLIRHQRIHTGEKPFECKECGKGFSQNTSLTQHQRI 323

  Fly   227 DMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSYCQTGFFNKSALKVHIHAHMGE 291
            ...|: |:.|..|.::|||...|..|..:|.    |..|::|..|..||...|.|..|...|.|:
Human   324 HTGEK-PYTCKECGKSFTRNPALLRHQRMHT----GEKPYECKDCGKGFMWNSDLSQHQRVHTGD 383

  Fly   292 RPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKHRRRHSDERPYKCSICL 356
            :||.|..|..:|..|..|..|.||||||:||:|..|.|.||.|:.|.||:|||:.::||.|.|  
Human   384 KPHECTDCGKSFFCKAHLIRHQRIHTGERPYKCNDCGKAFSQNSVLIKHQRRHARDKPYNCQI-- 446

  Fly   357 QDFREKHHLKRH 368
                  .||..|
Human   447 ------SHLLEH 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 4/11 (36%)
COG5048 <153..368 CDD:227381 80/216 (37%)
C2H2 Zn finger 153..173 CDD:275368 5/19 (26%)
C2H2 Zn finger 179..196 CDD:275368 6/16 (38%)
C2H2 Zn finger 207..227 CDD:275370 9/19 (47%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
C2H2 Zn finger 268..288 CDD:275368 7/19 (37%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 13/23 (57%)
zf-C2H2 322..344 CDD:278523 11/21 (52%)
C2H2 Zn finger 324..344 CDD:275368 10/19 (53%)
C2H2 Zn finger 352..368 CDD:275368 4/15 (27%)
ZNF662NP_001128128.1 KRAB 33..92 CDD:214630
KRAB 33..72 CDD:279668
C2H2 Zn finger 220..240 CDD:275368 1/19 (5%)
C2H2 Zn finger 248..268 CDD:275368 5/19 (26%)
zf-H2C2_2 264..284 CDD:290200 6/19 (32%)
COG5048 <272..427 CDD:227381 60/159 (38%)
C2H2 Zn finger 276..296 CDD:275368 8/19 (42%)
zf-H2C2_2 288..313 CDD:290200 9/24 (38%)
C2H2 Zn finger 304..324 CDD:275368 9/19 (47%)
zf-H2C2_2 316..341 CDD:290200 8/25 (32%)
C2H2 Zn finger 332..352 CDD:275368 7/19 (37%)
zf-H2C2_2 344..367 CDD:290200 7/26 (27%)
C2H2 Zn finger 360..380 CDD:275368 7/19 (37%)
zf-H2C2_2 372..395 CDD:290200 8/22 (36%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
zf-H2C2_2 400..425 CDD:290200 14/24 (58%)
C2H2 Zn finger 416..436 CDD:275368 10/19 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.