DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8319 and CG10147

DIOPT Version :9

Sequence 1:NP_649920.2 Gene:CG8319 / 41165 FlyBaseID:FBgn0037722 Length:383 Species:Drosophila melanogaster
Sequence 2:NP_001261477.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster


Alignment Length:451 Identity:107/451 - (23%)
Similarity:170/451 - (37%) Gaps:94/451 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DLCRICGGASENMLGIFDDQVEEYVDGAKLAEMVKTCADVQLDPD--DAMPQKMCISCVHDARTA 65
            |.||:|......     ||:....:....||.....|.::.:|||  |.:|.::|..|.......
  Fly     5 DKCRVCSSDVAR-----DDEAYNLLHHPYLAVKFSECTNLVVDPDDQDILPSEICSECYELLEKF 64

  Fly    66 YGFKRRC--EEN---------YKKFYLAILNGQVIKDEPNEEDF--LFIENPD----KGNLEAKK 113
            :.|:..|  .:|         :||........:|.:||..|.:.  |.:|.|:    ..||.|:.
  Fly    65 HSFRALCIIADNKWRSKSLVTWKKIDRRKPVYEVDEDEEEELELEELLLEPPEMIICDTNLSAQN 129

  Fly   114 ---------------KLNKEIKKTHQTASRTTKSSITTSRAGRQLRSIKNQTFKCELCIKQFKRQ 163
                           ...:.:::..:|..:..:....|             |:||:||..:|:.:
  Fly   130 TPIVAEQAPPTLVFHTFTENVQQPPETEKKALEEPPLT-------------TYKCDLCADEFREE 181

  Fly   164 INLLDHMKVHSNS---HVCQ-NCEERFLFKADLDNHQC-YRNSNSTVECPE--CLKVFSSTQSLD 221
            ..|:.|.|.|...   |..: .|||.|....:|..|:. :........|.|  |.:::....||.
  Fly   182 KRLILHKKEHQGHMLYHCTEPGCEEAFNRFENLRQHELEHSEVGMRFVCEEEGCNRMYRHKASLK 246

  Fly   222 SHKCKDMQERSPFQ---CPHCQQAFTREQNLKAHLLIHAESKQGNGPHKCSY--CQTGFFNKSAL 281
            .|:.|......|.:   |..|.:.|.....|..|...|.:  |...|:.|..  |...|::...|
  Fly   247 YHQSKAHDIGKPLKTHMCEFCGRVFKTGSALSQHRFTHGD--QLVLPYACELPECSMRFYSTEKL 309

  Fly   282 KVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPHCPKTFSDNNNLAKH-RRRHS 345
            |:|:..|.|.:..:||:|.....:|..|::||..||.|:.:.|..|||..:.:.:|.|| |..|.
  Fly   310 KIHMMRHQGIKNFSCPYCGLKKTTKNELRLHINYHTLERTWSCKDCPKVCNSSTSLKKHIRAIHE 374

  Fly   346 DERPYKCSICLQDF-----REKHHLKR--------HFLGK--------------HRDGDQK 379
            ..|.|.||.|.:.|     |:.|.:..        |..||              |..||.:
  Fly   375 KARDYACSYCEKKFATTDTRKYHEMTHTGEKNFECHVCGKKFIQPSALRTHRKVHESGDNQ 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8319NP_649920.2 zf-AD 4..79 CDD:285071 19/87 (22%)
COG5048 <153..368 CDD:227381 66/240 (28%)
C2H2 Zn finger 153..173 CDD:275368 7/19 (37%)
C2H2 Zn finger 179..196 CDD:275368 5/17 (29%)
C2H2 Zn finger 207..227 CDD:275370 6/21 (29%)
C2H2 Zn finger 236..256 CDD:275368 5/19 (26%)
C2H2 Zn finger 268..288 CDD:275368 6/21 (29%)
C2H2 Zn finger 296..316 CDD:275368 7/19 (37%)
zf-H2C2_2 308..332 CDD:290200 10/23 (43%)
zf-C2H2 322..344 CDD:278523 8/22 (36%)
C2H2 Zn finger 324..344 CDD:275368 8/20 (40%)
C2H2 Zn finger 352..368 CDD:275368 6/28 (21%)
CG10147NP_001261477.1 zf-AD 7..80 CDD:214871 18/77 (23%)
C2H2 Zn finger 171..191 CDD:275368 7/19 (37%)
zf-C2H2_8 199..287 CDD:292531 20/89 (22%)
C2H2 Zn finger 199..221 CDD:275368 6/21 (29%)
C2H2 Zn finger 230..253 CDD:275368 7/22 (32%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
C2H2 Zn finger 294..316 CDD:275368 6/21 (29%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 352..373 CDD:275368 8/20 (40%)
C2H2 Zn finger 381..401 CDD:275368 6/19 (32%)
C2H2 Zn finger 409..429 CDD:275368 3/19 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.